KEGG   Arabidopsis thaliana (thale cress): AT1G35680Help
Entry
AT1G35680         CDS       T00041                                 

Gene name
RPL21C
Definition
(RefSeq) Ribosomal protein L21
  KO
K02888  large subunit ribosomal protein L21
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT1G35680 (RPL21C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT1G35680 (RPL21C)
Ribosome [BR:ath03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    AT1G35680 (RPL21C)
  Bacteria
    AT1G35680 (RPL21C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L21p
Motif
Other DBs
NCBI-GeneID: 840472
NCBI-ProteinID: NP_174808
MIPS: AT1G35680.1
TAIR: AT1G35680
Araport: AT1G35680
UniProt: P51412
Position
1
AA seq 220 aa AA seqDB search
MASSSATLSLCSTFSAHCNVNSRRSSTILCSLSKPSLNLAKPLTGFLSPSTASTSRTAFT
VAPKFAESVVEAEPETTDIEAVVVSDVSEVTEEKAKREEIFAVIMVGGRQYIVFPGRYLY
TQRLKDANVDDQIVLNKVLLVGTKTHTYIGKPVVTNATVHAVVESQGLNDKVVVFKYKPK
KKYRRNIGHRQPNTRIRITGITGYEEYPASPNVAVGEVNL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcttcagcgacgctctctctctgctctactttctctgctcattgcaatgtc
aattctcgccgttctagcactatcctctgttctctctctaaaccttcgcttaatttggct
aaacctctgactggatttctttctccttccactgcgtcgacgtctcgaaccgcattcacc
gtcgctccgaaattcgcggaatcagtcgtcgaagctgaaccggagactaccgatatcgaa
gctgtggtggtttccgatgtttcggaggttactgaggaaaaagctaaacgagaagagatt
ttcgctgttattatggttggtggacgccaatacatagtgtttccagggagatatctctac
actcagaggctaaaagatgcaaatgttgatgaccagattgttctcaacaaagtgttgctt
gttggaacaaagacacacacttacattggcaagccggttgtgaccaatgccactgtacat
gctgttgtggaaagtcaaggtttgaatgataaagtggtagtcttcaagtacaagcctaag
aagaagtaccgtagaaatatcggtcacagacagccgaatacgaggattaggattaccgga
atcacagggtatgaagagtatccagcctcgcccaatgttgcagttggagaagtaaatctt
tga

DBGET integrated database retrieval system