KEGG   Arabidopsis thaliana (thale cress): AT1G43670Help
Entry
AT1G43670         CDS       T00041                                 

Gene name
FBP
Definition
(RefSeq) Inositol monophosphatase family protein
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00030  Pentose phosphate pathway
ath00051  Fructose and mannose metabolism
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
ath_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ath_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G43670 (FBP)
   00030 Pentose phosphate pathway
    AT1G43670 (FBP)
   00051 Fructose and mannose metabolism
    AT1G43670 (FBP)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G43670 (FBP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G43670 (FBP)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AT1G43670 (FBP)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G43670 (FBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 840953
NCBI-ProteinID: NP_175032
MIPS: AT1G43670.1
TAIR: AT1G43670
Araport: AT1G43670
UniProt: Q9MA79 A0A178WCE5
Position
1
AA seq 341 aa AA seqDB search
MDHAADAHRTDLMTITRFVLNEQSKYPESRGDFTILLSHIVLGCKFVCSAVNKAGLAKLI
GLAGETNIQGEEQKKLDVLSNDVFVNALVSSGRTSVLVSEEDEEATFVEPSKRGKYCVVF
DPLDGSSNIDCGVSIGTIFGIYTLDHTDEPTTADVLKPGNEMVAAGYCMYGSSCMLVLST
GTGVHGFTLDPSLGEFILTHPDIKIPNKGNIYSVNEGNAQNWDGPTTKYVEKCKFPKDGS
PAKSLRYVGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLMEQAGGQAFT
GKKRALDLVPEKIHERSPIFLGSYDDVEEIKALYAEEEKKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgcagcagatgctcaccgtacggatttgatgaccattacaagattcgtgttg
aatgaacaatcaaagtatccagaatctcgtggtgatttcaccattttgcttagtcacatc
gttttgggttgcaaattcgtttgcagtgctgttaataaggctggtttggctaagttaatt
ggacttgcaggggaaacaaacattcagggtgaagagcaaaagaaacttgatgtgctctct
aatgatgtctttgtcaacgctttggttagcagtggtagaacttctgttcttgtctcggag
gaagatgaggaagctacgtttgtggagccatccaagcgtggaaagtactgtgttgttttt
gatccgcttgatggatcttcaaacattgactgtggtgtttccattggcacaatttttgga
atttacacgttggaccacactgatgagccaaccactgcagatgttctgaaacctgggaat
gaaatggtggctgcaggttattgtatgtacggaagctcctgcatgcttgtgttgagcact
ggaaccggtgtccacggatttacactggacccatctctaggagagttcattctaactcac
ccggacattaagattccaaataagggaaacatttattcggtgaatgaaggcaatgcgcag
aactgggatggtccaactacaaagtatgtagagaaatgcaagtttcctaaagatggttct
cctgcaaagtctctgagatacgtaggaagtatggtagctgatgttcatcgtacactactt
tatggaggaatcttcttgtacccggctgacaagaaaagccccaatggaaaattgcgtgtc
ttgtatgaagttttcccgatgtcgtttttgatggagcaagccggaggtcaggcctttacg
ggaaagaaaagggcgctagaccttgtcccggagaagatccatgagcgttctccgatattt
cttggtagctacgatgatgtagaagagattaaagctctctatgctgaggaggaaaagaag
aactaa

DBGET integrated database retrieval system