KEGG   Arabidopsis thaliana (thale cress): AT1G44750
Entry
AT1G44750         CDS       T00041                                 
Symbol
PUP11
Name
(RefSeq) purine permease 11
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PUNUT
Other DBs
NCBI-GeneID: 841039
NCBI-ProteinID: NP_175096
TAIR: AT1G44750
UniProt: Q9LPF6
Position
1:16892527..16896089
AA seq 379 aa
MAKEPVRVLVTGAAGNQEPILVKEESVVGIPTPLLKLKSWQWWVLVSVNIFFLIGGQAAS
VLLGRFYYDEGGNSKWMATLVQTAAFPILYIPLLLLPSSASVESSESSCSLKYIVLIYVL
LGVIIAGDNMLYSVGLLYLSASTYSLICATQLAFNAVFSYFINAQKFTALILNSVVLLSF
SAALIALNDDADTPSGVSRSKYIVGFVCTLAASALYSLLLSLMQFSFEKILKRETFSVVL
EMQIYTSLVATCVSVIGLFASGEWRTLHGEMEGYHKGQASYVLTLVWTAVTWQVCSVGVV
GLIFLVTSLFSNVISTLSLAVTPLAALVVFRDKMSGVKIMAMLIAIWGFASYVYQNHIDD
LKVRQARQQAQAGRVEPPC
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcgaaggaaccagttcgtgttcttgttaccggagctgcaggtaatcaagaaccaatc
ttggtgaaagaagagagtgtggttggtataccaacaccactcttgaagcttaaaagttgg
caatggtgggttcttgtatccgttaacatctttttccttattggtggtcaagctgcttcg
gttcttcttggtaggttttactatgatgaaggtggaaacagtaaatggatggcaactctt
gttcaaacggctgcttttcctatactctatatcccgcttttgctacttccgtcttcggct
agtgtagagtcttcggagagttcgtgttcactcaagtacattgttttgatctatgttttg
ctcggtgtgatcattgctggagataatatgttatactctgttggacttttgtacctctct
gcatcgacgtattcgctcatttgcgctactcagttagctttcaacgcggtgttctcttat
ttcatcaatgctcagaagttcactgctttgattctcaactccgttgttctcttgtcgttc
tccgctgctttgatagctctcaatgatgatgcggatactccttctggtgtctccaggtct
aagtatattgttgggtttgtgtgtacacttgctgcgtctgctctctattctctgttgcta
tctcttatgcagttctcgttcgagaagattctgaagagggagacgttttctgtggttctt
gaaatgcaaatctacacttctttagtggcgacttgtgtttcggttatagggctttttgct
agcggggaatggagaacgctgcatggggaaatggaaggttatcataaagggcaagcctct
tatgtactgaccttggtctggacagcagttacttggcaagtgtgttctgttggagtcgtg
ggtttgatatttctggtgacgtcgctcttctcaaacgtcattagtacgctctctctagct
gtgactccactagcagctttggttgtgttccgtgataaaatgagtggtgttaagattatg
gcaatgctgatcgctatttggggtttcgcttcttatgtttaccagaatcatattgatgac
ttgaaagtaagacaagcacgacaacaagctcaagccgggcgggtagaaccgccctgttga

DBGET integrated database retrieval system