KEGG   Arabidopsis thaliana (thale cress): AT1G44900Help
Entry
AT1G44900         CDS       T00041                                 

Gene name
MCM2
Definition
(RefSeq) minichromosome maintenance (MCM2/3/5) family protein
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
Module
ath_M00285  MCM complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G44900 (MCM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G44900 (MCM2)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G44900 (MCM2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AT1G44900 (MCM2)
DNA replication proteins [BR:ath03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    AT1G44900 (MCM2)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    AT1G44900 (MCM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_5 AAA_3 AAA_lid_2 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 841056
NCBI-ProteinID: NP_175112
MIPS: AT1G44900.1
TAIR: AT1G44900
Araport: AT1G44900
UniProt: Q9LPD9
Position
1
AA seq 936 aa AA seqDB search
MAGENSDNEPSSPASPSSAGFNTDQLPISTSQNSENFSDEEEAAVDTQVIRDEPDEAEDE
EEEEGEDLFNDTFMNDYRKMDENDQYESNGIDDSVDDERDLGQAMLDRRAADADLDAREN
RLANRKLPHLLHDNDSDDWNYRPSKRSRTTVPPRGNGGDPDGNPPSSPGVSQPDISMTDQ
TDDYQDEDDNDDEAEFEMYRIQGTLREWVMRDEVRRFIAKKFKDFLLTYVKPKNENGDIE
YVRLINEMVSANKCSLEIDYKEFIHVHPNIAIWLADAPQPVLEVMEEVSEKVIFDLHPNY
KNIHTKIYVRVTNLPVNDQIRNIRQIHLNTMIRIGGVVTRRSGVFPQLQQVKYDCNKCGA
VLGPFFQNSYSEVKVGSCSECQSKGPFTVNVEQTIYRNYQKLTIQESPGTVPAGRLPRHK
EVILLNDLIDCARPGEEIEVTGIYTNNFDLSLNTKNGFPVFATVVEANYVTKKQDLFSAY
KLTQEDKTQIEELSKDPRIVERIIKSIAPSIYGHEDIKTALALAMFGGQEKNIKGKHRLR
GDINVLLLGDPGTAKSQFLKYVEKTGQRAVYTTGKGASAVGLTAAVHKDPVTREWTLEGG
ALVLADRGICLIDEFDKMNDQDRVSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPVG
GRYDSSKSFAQNVELTDPILSRFDILCVVKDVVDPVTDEMLAEFVVNSHFKSQPKGGKME
DSDPEDGIQGSSGSTDPEVLPQNLLKKYLTYSKLYVFPKLGELDAKKLETVYANLRRESM
NGQGVSIATRHLESMIRMSEAHARMHLRQYVTEEDVNMAIRVLLDSFISTQKFGVQRTLR
ESFKRYITYKKDFNSLLLVLLKELVKNALKFEEIISGSNSGLPTIEVKIEELQTKAKEYD
IADLRPFFSSTDFSKAHFELDHGRGMIKCPKRLITW
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagaaaattccgataacgagccgtcttcaccagcttcaccttcttccgctgga
ttcaacacagatcagttaccaatcagtacaagccaaaactccgaaaatttctccgatgaa
gaagaagcagctgtagatacccaagtcattagagatgagcctgacgaagcggaggatgaa
gaagaagaagaaggagaagatctcttcaatgatacttttatgaacgattatcggaagatg
gatgagaatgatcagtatgagtctaatggaatagatgattccgtcgatgatgaaagagat
ttaggtcaggctatgcttgaccgtcgtgctgctgacgctgatcttgatgctcgtgaaaat
cgacttgcgaatcgcaagcttcctcatcttcttcacgataacgattcagatgattggaac
tatagaccttcgaagaggtctcgaactacggttccaccgagaggtaatggtggtgatcct
gatgggaatcctccaagttcgccaggagtgtcacagccagatatctctatgactgatcaa
actgatgattatcaagatgaggatgataatgatgatgaagcagagtttgagatgtatagg
attcaaggaactctgagggaatgggttatgagagatgaagtgagacggtttattgctaag
aagtttaaagactttttgcttacgtatgttaaaccaaagaatgagaatggagatattgaa
tatgttcgtttaattaacgaaatggtttcagctaataagtgcagtctggaaattgattac
aaagaattcatacacgtccacccgaatattgcaatctggcttgcggatgctccacaacct
gtgcttgaagtaatggaggaagtttctgaaaaggtcatctttgatctgcatccaaactac
aagaatattcacacgaagatatatgttcgtgttaccaacctaccagttaatgatcagatt
cggaacatcaggcagattcatcttaacacgatgatccgtatcggtggagttgtcactagg
cgttctggggtctttcctcagctgcagcaagtgaaatatgattgtaacaagtgtggagca
gttttggggcctttcttccaaaactcttattcagaagtcaaggtcggttcttgttctgaa
tgccagtcaaaaggaccgtttactgttaatgtcgaacagacaatatacaggaactatcag
aagcttacaatccaagagagtccaggaacagtgcctgctggacgacttccaagacacaaa
gaagttatcctgctgaatgaccttattgattgcgctcgtcctggggaagaaattgaggtt
actggcatatataccaacaactttgacctatctttgaacacaaagaatgggtttccagtc
tttgccactgtggtggaagctaactatgttacaaagaaacaagacctcttctctgcgtac
aagctaacccaagaagacaagacacaaatcgaagagctatccaaggatccacgaatagtt
gaacgtatcattaagtcaattgctccgtcaatatatggccacgaagatatcaaaacagct
cttgctcttgctatgtttggtggccaagagaaaaatatcaaagggaaacacagattgcgt
ggagatattaatgtacttttactaggtgatccaggaacagcaaaatcacaatttctgaag
tatgttgaaaaaactggtcaaagagctgtctacacgactggaaagggagcttctgctgtt
ggtctaaccgcagcagtacacaaagatccagttacaagggagtggacgcttgaaggaggg
gctcttgtacttgctgaccgaggaatttgtcttatcgatgagtttgacaagatgaacgac
caggacagggtgagtatccatgaagccatggaacaacagagtattagtatatcgaaggca
ggaatagttacttctcttcaagctcgttgctctgttattgctgcagctaatccagttggt
ggaaggtatgattcatcgaaatcatttgcacaaaatgtcgagttgacagatccgatcctt
tctcgttttgatatcttgtgtgttgtcaaggatgtggttgacccagttacagatgaaatg
ctagctgaatttgttgtcaatagccacttcaagtcacaacccaaaggtggtaagatggaa
gatagcgatcccgaagatggcattcagggatctagcgggtcaactgatccggaggtcctt
cctcagaacctgctgaagaaatacttaacatactcgaagttgtatgtattcccaaaactg
ggtgaactagatgccaagaagttagagactgtttatgctaatctaagacgagaatcaatg
aacggacaaggagtttctatagcgacaaggcaccttgagtccatgatccgaatgtctgaa
gcacatgctaggatgcaccttaggcaatatgtcacagaagaggatgttaatatggccatt
cgagtcctacttgactctttcatatcaacccagaaatttggtgtccagagaactctaaga
gagagtttcaaacggtacattacatacaaaaaggacttcaactcattgctgctcgttctt
ctcaaagagctcgtaaagaacgccttgaagtttgaagaaatcatttcaggatcgaactca
ggactacctacaatcgaggttaagatagaggaactgcagacaaaggccaaggaatacgac
attgcagatctacgacccttcttttcaagcacagatttttccaaagctcacttcgagttg
gatcatggccgaggaatgatcaagtgtccaaaaaggctgatcacttggtaa

DBGET integrated database retrieval system