KEGG   Arabidopsis thaliana (thale cress): AT1G47750
Entry
AT1G47750         CDS       T00041                                 

Symbol
PEX11A
Name
(RefSeq) peroxin 11A
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PEX11
Other DBs
NCBI-GeneID: 841186
NCBI-ProteinID: NP_564514
TAIR: AT1G47750
UniProt: Q9FZF1
Position
1:complement(17569256..17570249)
AA seq 248 aa
MATKAPEKITKPKDRDFLNHLETYLSKRDGVDKLLKISRYATKIILASSLIPETRSIIPR
LKSFESSVGVSRKAFRLGKFVQDINALRSSRWDSNHELVLLIIAYGGEGLYYFVEQFIWL
TKSGLIDAKHSKWLQKISAWAELVGYVGSVSIKIRDLRKLNDEESCVASTIEISVSRGLA
CDGEDEKMKMIKEKKTLKVLSILQDLADGLMTIADIRDGKGVLSAPNVISSAGLFSAIVS
THKNWISC
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctacgaaagctccagagaaaatcaccaaaccaaaagacagagatttcctaaatcat
ctcgaaacatatctctccaaaagagatggtgtagacaaactcctgaaaatctctcgttac
gcaacaaaaatcatcctcgcatcatcactaatcccagaaaccagatccataatcccccga
ctcaaaagcttcgaatcaagcgtcggagtcagtcgcaaagccttccgtctcggaaaattc
gtacaagacatcaacgcattaagatcctcacgatgggattcaaatcacgagctcgtctta
ctcataatcgcgtacggtggtgaaggattatactatttcgttgaacaattcatatggtta
acgaaatcaggactgatcgatgcgaaacattcgaaatggcttcagaagattagtgcttgg
gctgaattggttggttatgtaggaagtgtttcgattaagattagggatttgaggaaattg
aatgatgaagagagttgtgttgcttcgacgatcgagatctcggtttcgagaggattagct
tgtgatggtgaagatgagaagatgaagatgattaaggagaagaagacattgaaggtttta
tctattttgcaggatcttgctgatggtttgatgacgattgctgatattcgtgatggtaag
ggagtgttatcggctcctaatgtgatatcttctgcaggtttgttttctgctattgttagt
actcataagaactggatctcttgttga

DBGET integrated database retrieval system