KEGG   Arabidopsis thaliana (thale cress): AT1G48350
Entry
AT1G48350         CDS       T00041                                 
Symbol
EMB3105
Name
(RefSeq) Ribosomal L18p/L5e family protein
  KO
K02881  large subunit ribosomal protein L18
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT1G48350 (EMB3105)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT1G48350 (EMB3105)
Ribosome [BR:ath03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AT1G48350 (EMB3105)
  Bacteria
    AT1G48350 (EMB3105)
  Archaea
    AT1G48350 (EMB3105)
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-GeneID: 841255
NCBI-ProteinID: NP_175268
TAIR: AT1G48350
UniProt: Q9SX68 A0A384KQD1 Q0WWC5
Position
1:17867102..17868432
AA seq 170 aa
MTSVSGCGSVSLITNRSAFLGNGLQHRAVFLKPWSSSSLQSRSMVVEAKTKTSSEDRIAR
HSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLASASTKQKPISEEFDYTSGPT
IEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAAREHGLQF
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacgagcgtgagtgggtgtggttcagtgagtctgataactaaccgcagtgcgttcttg
ggaaacggacttcaacaccgtgccgttttccttaaaccatggtcgtcttcttcgcttcag
tctcggtccatggttgtcgaagccaaaaccaaaaccagcagcgaagacagaatcgcccgc
cactctcgtatccgtaagaaggttaatggtacaacggagaggccaaggctatgtgttttc
cgatcaaacaagcatctttatgttcaagtgattgatgataccaagatgcacaccttagct
tcagcttccactaagcagaaaccaatctctgaagagttcgactacacctctggaccaacc
attgaggtagcgaagaaagttggggaagtgatagcaaaatcttgcttggagaaaggtatc
acaaaggtagcctttgaccgtggtggttacccttaccatggacgtattgaggctcttgct
gctgcagcacgtgaacacggtcttcagttttaa

DBGET integrated database retrieval system