KEGG   Arabidopsis thaliana (thale cress): AT1G48470
Entry
AT1G48470         CDS       T00041                                 
Symbol
GLN1;5
Name
(RefSeq) glutamine synthetase 1;5
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath00250  Alanine, aspartate and glutamate metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath00910  Nitrogen metabolism
ath01100  Metabolic pathways
ath01230  Biosynthesis of amino acids
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G48470 (GLN1;5)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AT1G48470 (GLN1;5)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT1G48470 (GLN1;5)
   00220 Arginine biosynthesis
    AT1G48470 (GLN1;5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT1G48470 (GLN1;5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G48470 (GLN1;5)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     AT1G48470 (GLN1;5)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G48470 (GLN1;5)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-GeneID: 841268
NCBI-ProteinID: NP_175280
TAIR: AT1G48470
UniProt: Q8GXW5
Position
1:17913711..17916101
AA seq 353 aa
MTSPLSDLLNLDLSDTKKIIAEYIWIGGSGMDIRSKARTLPGPVSNPTKLPKWNYDGSST
DQAAGDDSEVILYPQAIFKDPFRKGNNILVMCDAYRPAGDPIPTNNRHKAVKIFDHPNVK
AEEPWFGIEQEYTLLKKDVKWPLGWPLGGFPGPQGPYYCAVGADKAFGRDIVDAHYKACL
YSGLSIGGANGEVMPGQWEFQISPTVGIGAGDQLWVARYILERITEICGVIVSFDPKPIQ
GDWNGAAAHTNFSTKSMRKDGGLDLIKEAIKKLEVKHKQHIAAYGEGNERRLTGKHETAD
INTFSWGVADRGASVRVGRDTEKEGKGYFEDRRPSSNMDPYLVTSMIAETTIL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgacgtctcctctctcagatctcctaaaccttgatctatcagacaccaagaaaatcatc
gctgaatacatatggatcggtggctctggaatggatattagaagcaaagccaggacatta
ccaggaccagtaagtaatccaacaaagcttccaaaatggaactacgatggatctagcacc
gatcaagctgccggagatgatagtgaagtcattctttatcctcaggcaatatttaaggac
ccattcaggaaggggaacaacattctggtgatgtgtgatgcttacagaccggccggagat
ccaattccgaccaacaataggcacaaggccgtaaaaatcttcgatcatcccaatgtgaag
gctgaagagccttggtttgggatagagcaagaatacacattacttaaaaaagatgtgaag
tggccactaggttggcctcttggtggctttcctggtcctcagggaccgtactattgtgca
gtaggtgcagacaaagcttttggtcgtgacattgtcgatgctcactataaagcttgtcta
tactccggtttgagtattggtggtgccaatggtgaagtcatgcctggacaatgggagttt
caaatcagtcctactgttggtattggtgcaggtgatcaattatgggttgctcgttacatt
cttgagaggattactgagatatgcggtgtgattgtctcattcgatccaaaaccaatccag
ggtgattggaatggagcagccgctcatacgaacttcagtacaaaatcgatgaggaaagat
ggaggactggatttgattaaggaagcaataaagaagcttgaagtgaaacacaaacaacac
attgctgcttatggtgaaggcaacgagaggcgtctcactgggaagcatgaaactgcagac
atcaacactttctcttggggagtggcggatcgtggagcatcggtgagagtaggaagagat
acggagaaagaaggtaaagggtattttgaagatcgaaggccttcgtctaatatggatcct
tacctagttacctccatgattgctgaaaccaccatcctctaa

DBGET integrated database retrieval system