KEGG   Arabidopsis thaliana (thale cress): AT1G50430Help
Entry
AT1G50430         CDS       T00041                                 

Gene name
DWF5
Definition
(RefSeq) Ergosterol biosynthesis ERG4/ERG24 family
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00100  Steroid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    AT1G50430 (DWF5)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     AT1G50430 (DWF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24
Motif
Other DBs
NCBI-GeneID: 841465
NCBI-ProteinID: NP_175460
MIPS: AT1G50430.1
TAIR: AT1G50430
Araport: AT1G50430
UniProt: Q9LDU6 Q0WU95 A0A178W1U5
Position
1
AA seq 432 aa AA seqDB search
MAETVHSPIVTYASMLSLLAFCPPFVILLWYTMVHQDGSVTQTFGFFWENGVQGLINIWP
RPTLIAWKIIFCYGAFEAILQLLLPGKRVEGPISPAGNRPVYKANGLAAYFVTLATYLGL
WWFGIFNPAIVYDHLGEIFSALIFGSFIFCVLLYIKGHVAPSSSDSGSCGNLIIDFYWGM
ELYPRIGKSFDIKVFTNCRFGMMSWAVLAVTYCIKQYEINGKVSDSMLVNTILMLVYVTK
FFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSVYTSPGMYLVNHPVELGTQLAIYILVA
GILCIYINYDCDRQRQEFRRTNGKCLVWGRAPSKIVASYTTTSGETKTSLLLTSGWWGLA
RHFHYVPEILSAFFWTVPALFDNFLAYFYVIFLTLLLFDRAKRDDDRCRSKYGKYWKLYC
EKVKYRIIPGIY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcggagactgtacattctccgatcgttacttacgcatcgatgttatcgcttctcgcc
ttctgtccacctttcgtcattctcctatggtacacaatggttcatcaggatggttctgtt
actcagacctttggcttcttttgggagaatggagttcaaggacttatcaacatatggcca
agacccactttgattgcttggaaaattatattttgctatggagcatttgaagctattctt
cagctgcttctgcctggtaaaagagttgagggtccaatatctccagccggaaaccgacca
gtttacaaggccaatggtctggctgcttactttgtgacactagcaacctatcttggtctt
tggtggtttggaatcttcaaccctgcaattgtctatgatcacttgggtgaaatattttcg
gcactaatattcggaagcttcatattttgtgttttgttgtacataaaaggccatgttgca
ccttcatcaagtgactctggttcatgtggtaacctaataattgacttctattggggcatg
gagttgtaccctcgaattggtaagagctttgacatcaaggtgtttactaattgcagattc
ggaatgatgtcttgggcagttcttgcagtcacgtactgcataaaacagtatgaaataaat
ggcaaagtatctgattcaatgctggtgaacaccatcctgatgctggtgtatgtcacaaaa
ttcttctggtgggaagctggttattggaacaccatggacattgcacatgaccgagctgga
ttctatatatgctggggttgtctagtgtgggtgccttctgtctacacttctccaggcatg
taccttgtgaaccaccccgtcgaactcggaactcagttggcaatatacattctcgttgca
ggaattctgtgcatttacataaactatgactgtgatagacaaaggcaagagttcaggagg
acaaacgggaaatgtttggtttggggaagggccccgtcaaagattgtggcgtcgtatact
acaacatctggtgaaactaaaactagtcttctcttaacgtctggatggtggggattggct
cgtcatttccattatgttcctgagatcttaagtgctttcttctggaccgtaccggctctc
ttcgataacttcttggcatacttctacgtcatatttctcacccttcttctctttgatcga
gccaagagagacgatgaccgatgccgatcaaagtatgggaaatattggaagctgtattgt
gagaaagtcaaatacaggatcattccgggaatttattga

DBGET integrated database retrieval system