KEGG   Arabidopsis thaliana (thale cress): AT1G51500
Entry
AT1G51500         CDS       T00041                                 

Gene name
ABCG12
Definition
(RefSeq) ABC-2 type transporter family protein
Organism
ath  Arabidopsis thaliana (thale cress)
Motif
Pfam: ABC2_membrane ABC_tran ABC2_membrane_7 AAA_21 AAA_29 AAA_16 RsgA_GTPase SMC_N AAA_25 Cytidylate_kin AAA_22 NACHT AAA_33 AAA_5 AAA_23 Rad17 AAA_17 AAA_18 NB-ARC MMR_HSR1 RNA_helicase DUF87 AAA_30
Other DBs
NCBI-GeneID: 841575
NCBI-ProteinID: NP_175561
TAIR: AT1G51500
UniProt: Q9C8K2 A0A178W3S0
Position
1
AA seq 687 aa
MELESTSNGRRPPPPAEIGRGAYLAWEDLTVVIPNFSGGPTRRLLDGLNGHAEPGRIMAI
MGPSGSGKSTLLDSLAGRLARNVIMTGNLLLNGKKARLDYGLVAYVTQEDILMGTLTVRE
TITYSAHLRLSSDLTKEEVNDIVEGTIIELGLQDCADRVIGNWHSRGVSGGERKRVSVAL
EILTRPQILFLDEPTSGLDSASAFFVIQALRNIARDGGRTVVSSIHQPSSEVFALFDDLF
LLSSGETVYFGESKFAVEFFAEAGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIRE
TPATSDPLMNLATSEIKARLVENYRRSVYAKSAKSRIRELASIEGHHGMEVRKGSEATWF
KQLRTLTKRSFVNMCRDIGYYWSRIVIYIVVSFCVGTIFYDVGHSYTSILARVSCGGFIT
GFMTFMSIGGFPSFIEEMKVFYKERLSGYYGVSVYIISNYVSSFPFLVAIALITGSITYN
MVKFRPGVSHWAFFCLNIFFSVSVIESLMMVVASLVPNFLMGLITGAGIIGIIMMTSGFF
RLLPDLPKVFWRYPISFMSYGSWAIQGAYKNDFLGLEFDPMFAGEPKMTGEQVINKIFGV
QVTHSKWWDLSAIVLILVCYRILFFIVLKLKERAEPALKAIQAKRTMKSLKKRPSFKKVP
SLSSLSSRRHQPLHSLSSQEGLTSPIN
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggagttagagagtacgagcaatggccgacgtccgccgccaccggcagagattggccgt
ggggcgtacttggcgtgggaagatttgacggtggttataccaaactttagtggtggtccg
actcgaagattgctcgatggattaaacggtcatgctgaaccaggtcggattatggccatt
atgggtccttccggatccggcaagtccacgcttcttgattctctcgcaggtagactcgca
agaaacgtgattatgaccggtaatcttctattgaacggaaagaaggcaagactagactac
ggtctcgtcgcttatgtaacacaagaggacattttgatgggaacactaacggtgagggag
acaataacatactcagctcatctacggctatcaagtgatttgaccaaagaagaagtcaac
gacattgttgaaggaacaatcattgaacttggtcttcaagattgtgcagacagagtcata
ggtaattggcattctagaggagtgagtggcggcgagaggaaacgcgtcagcgttgcgtta
gagatcttaacgcgaccgcaaattttgtttcttgatgaacctactagtggtttggacagt
gcttctgctttctttgtgattcaagcgctaaggaatatcgctcgagatggtggtagaacc
gttgtttcatcgattcatcaacctagtagcgaagtttttgctctctttgatgatcttttt
ttgctctctagtggtgagactgtttattttggtgaatccaagtttgctgttgagttcttt
gctgaagcggggtttccttgcccgaagaaacggaatccttctgatcatttcctaagatgt
atcaactcagactttgataccgttacagctacactcaaaggatctcaaaggattcgggag
acaccagctacatcagatcctttgatgaatctagcaacatctgagatcaaagctaggctt
gttgagaattatcgtcgttcagtctacgctaaatctgcaaaatctcgcatccgtgaatta
gctagcattgaaggacatcatgggatggaagtgagaaagggaagcgaagcgacgtggttt
aagcagctaagaactttgacaaagagatcatttgtgaacatgtgccgcgatattggatac
tattggtcaagaattgtgatctatattgtggtatcattctgtgttgggacaatcttttac
gatgtaggacatagctacacatcgatcttggctcgggtttcttgtggtggattcattacc
ggtttcatgactttcatgtccattggagggtttccttctttcattgaagaaatgaaagtg
ttctataaagagagattgagtggttactacggcgtttcggtttatatcatatcgaattac
gtctcttctttcccgttcttggtagccattgcgctcatcacagggagtattacttacaac
atggtgaaattccgtcctggtgtctcgcattgggctttcttctgtctcaacatattcttc
tctgtctccgtcattgagagtctcatgatggttgtggcttctcttgttccgaatttcttg
atgggtcttatcacaggagctggcatcattggaatcatcatgatgacttctggattcttc
cgtttgcttcccgatctgccaaaggttttctggcgctacccgatttccttcatgagttat
ggttcttgggctattcagggagcatacaagaatgattttcttggtctagagtttgacccg
atgtttgcgggggaaccaaagatgacaggagagcaagtgataaacaagatatttggagtg
caagtcacacattctaagtggtgggacttatcagcgatcgtgttgatccttgtgtgttac
cgcattctatttttcatagtcttgaagcttaaggagagagcagagccggctttgaaggcg
atacaagcaaagcgaacgatgaagagtctcaaaaagagaccttctttcaagaaagttcca
tctctatcatcactatcttcaaggagacaccaacctctacattcactttcttctcaagaa
ggtcttacctctccaattaattaa

DBGET integrated database retrieval system