KEGG   Arabidopsis thaliana (thale cress): AT1G52370Help
Entry
AT1G52370         CDS       T00041                                 

Definition
(RefSeq) Ribosomal protein L22p/L17e family protein
  KO
K02890  large subunit ribosomal protein L22
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT1G52370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT1G52370
Ribosome [BR:ath03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AT1G52370
  Bacteria
    AT1G52370
  Archaea
    AT1G52370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 841667
NCBI-ProteinID: NP_001031174
MIPS: AT1G52370.1
TAIR: AT1G52370
Araport: AT1G52370
UniProt: Q56W16
Position
1
AA seq 269 aa AA seqDB search
MAGWQKNLQIVIRQVGKRVKDSHISTANYSSTRNLESPFSQGYLQSLLRSTYSSRPLYYH
LQQLGISTSRQLQAGEEPVSSPLSSPALLGSGKEEEQKIIPKRQKVQAVLKSIKQSPKKV
NLVAALVRGMRVEDALMQLQVTVKRASQTVYRVIHAARANATHNHGLDPDRLLVAEAFVG
KGLFGKKVAYHAKGRSGIISIPRCRLTVIVRETTAEEEAEIARLKVHNFKKLNKRQRQLV
PHKLIETSPIWNRRGTKGNHRSSELVPSH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcgggttggcagaagaatttacagattgttattcgtcaagttggtaaaagagttaag
gacagtcacatttccacggcaaattactcttccacacggaatttggaatcccctttctca
caaggttatttgcagagtctcttgagatcaacctattcctcaagaccactgtattatcat
ctacaacaactgggaatttctacctcaagacaattgcaggcgggtgaggagcctgtatca
tcacctttgtcatctccagctctgctgggtagtggaaaagaagaagagcagaagattatc
ccaaagcgtcagaaagttcaggctgtcctcaagtccataaagcagagtcctaagaaggtc
aacttggttgcagcactagtccgtggcatgcgtgttgaagatgctttgatgcaattgcag
gtcacggtcaaacgagcttcacaaactgtgtaccgggttatacatgctgcgcgggcaaat
gctactcataaccatggactagatcctgaccgtctccttgttgcggaagcgtttgttggg
aagggactctttgggaagaaggtagcttaccatgcaaaaggaagaagcgggataatatca
atacccaggtgtcgtctaacagtcatagtcagagagacgactgcagaggaagaagctgag
attgcaaggctgaaagttcacaattttaagaagctaaacaagcggcagagacagctggta
ccacacaagttgatcgagacaagtccaatctggaaccgcagaggtaccaaaggcaatcac
aggtcatctgagttggtaccgtctcactaa

DBGET integrated database retrieval system