KEGG   Arabidopsis thaliana (thale cress): AT1G53720Help
Entry
AT1G53720         CDS       T00041                                 

Gene name
CYP59
Definition
(RefSeq) cyclophilin 59
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ath03041]
    AT1G53720 (CYP59)
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT1G53720 (CYP59)
Enzymes [BR:ath01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AT1G53720 (CYP59)
Spliceosome [BR:ath03041]
 Complex C
  Other components
   PPlases
    AT1G53720 (CYP59)
Chaperones and folding catalysts [BR:ath03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    AT1G53720 (CYP59)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1 zf-CCHC
Motif
Other DBs
NCBI-GeneID: 841810
NCBI-ProteinID: NP_175776
MIPS: AT1G53720.1
TAIR: AT1G53720
Araport: AT1G53720
UniProt: Q6Q151
Position
1
AA seq 506 aa AA seqDB search
MSVLIVTSLGDIVIDLHSDKCPLTCKNFLKLCKIKYYNGCLFHTVQKDFTAQTGDPTGTG
AGGDSIYKFLYGEQARFYKDEIHLDLKHSKTGTVAMASGGENLNASQFYFTLRDDLDYLD
GKHTVFGQIAEGFDTLTRINEAYVDPKNRPYKNIRIKHTHILDDPFDDPPQLAEMMPDAS
PEGKPKEEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAHSSAVVLESIGDIPEAEVKP
PDNVLFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQA
YFKMDNALIDDRRIHVDFSQSVSKLWSQFRQKDSQKGKGNGCFKCGSTDHIAKDCVGGPS
SKFIVKDQNRQHGGGEGYEMVFEGDVHETPKHNSHERERSEKIQRRSPHGNGEGKRQHRD
ERDDGRRQHDREDARELERKHRERKERESREDEDRRRRRRREESRDKESRRERDEDDHRS
HRDYKERRRERDDRHGREARHERRDR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttcttattgtgacgagccttggtgatatagtaattgaccttcactcggataaa
tgccctttgacttgcaagaacttccttaagctttgcaagatcaagtactacaatgggtgt
ctttttcacactgtgcaaaaggatttcacagcacagactggtgatccaactggtacggga
gctggtggagattcaatctacaaatttctgtacggtgagcaggctcgtttttacaaagat
gagattcatcttgatttaaaacattcaaagaccggcactgttgcaatggccagtggtgga
gagaatctcaatgcttcccagttctatttcacacttcgtgatgatttggactatcttgat
gggaaacacactgtgtttggacagattgctgaggggtttgacactttgactaggataaat
gaagcttatgttgatccgaagaacagaccctataagaacattagaatcaagcacacacat
atacttgatgatccatttgatgatcccccacagctggctgaaatgatgccagatgcttcc
cctgaaggaaaaccgaaagaagaggtcaaagatgacgtgcggcttgaagatgattgggtt
ccaatggatgaagaacttggtgctcaggaactggaggaggttatccgcgaaaaggcagcc
cattcaagtgctgttgtacttgaaagtataggagatatccccgaggctgaggtaaaacct
cctgacaatgtgctgttcgtctgcaaactgaatccagtgactgaggatgaagacctccat
accattttttcacgctttggaaccgttgtatcggctgatgtaatccgggatttcaagaca
ggtgacagtttgtgctatgcttttatagagtttgagaacaaggagtcatgcgaacaagcg
tactttaagatggacaatgctctgatcgatgatagacggatacatgtggatttcagtcag
agtgtgtccaaactttggtcacagttcaggcaaaaagactcccaaaagggcaaagggaat
gggtgtttcaaatgcggctcgacggatcatattgccaaggactgtgtgggtggtccgtct
tcaaagtttattgtaaaagatcaaaacagacagcacggaggaggtgaaggctatgagatg
gtgtttgagggtgatgtgcatgaaacccccaagcataatagtcatgagagggagaggagt
gagaagattcagaggagaagtcctcatggtaatggggaaggcaaaagacagcacagagat
gaacgtgatgatggtagaagacagcatgatcgggaagacgcacgagaactggagaggaaa
cacagagagagaaaagaaagagagagtagggaagatgaagacagaagaagaagaagacgc
cgtgaagagtctagagataaagagagtcggagagagagagacgaagatgatcatcggagt
catagagattataaagagaggagaagagagagagacgatagacatggaagagaagctaga
catgagagaagggatagatga

DBGET integrated database retrieval system