KEGG   Arabidopsis thaliana (thale cress): AT1G53950Help
Entry
AT1G53950         CDS       T00041                                 

Definition
(RefSeq) ubiquitin-40S ribosomal S27a-like protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 28717351
NCBI-ProteinID: NP_001319219
MIPS: AT1G53950.1
TAIR: AT1G53950
Araport: AT1G53950
UniProt: Q9SYF2
Position
1
AA seq 144 aa AA seqDB search
MYKKRQRGEREREIKVEFAMHISIKTLEGKRIKLEVEDSSNTIDLKIHGEPTRELVVDLS
PTPDTGAIMMIFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEGIPVEQQRLIFQGRVLED
SKAISDYNIKHESTLHITLHQCGC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaaaagacagagaggagagagagagagagagataaaagttgagtttgctatg
catatttcgattaagacgttggagggaaagaggataaagctagaggttgaagatagctcc
aacaccatcgacctcaagatccatggagagccgacccgtgaattggttgtggatctgagt
ccaactccagatacgggtgcgatcatgatgatttttattaagactcttacggggagaacc
aacacctacgaggttaaggggtctgacaccattagagaactcaaggccaagcatgaggag
aaagaaggcattccagtagaacagcagaggctaatctttcaaggcagggtactcgaggat
agtaaagccatatctgactataacatcaagcatgagtcgacccttcacataacgttacat
caatgtggttgctaa

DBGET integrated database retrieval system