KEGG   Arabidopsis thaliana (thale cress): AT1G53980Help
Entry
AT1G53980         CDS       T00041                                 

Definition
(RefSeq) Ubiquitin-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ubiquitin_4 DUF2501 DUF4342 Rad60-SLD
Motif
Other DBs
NCBI-GeneID: 28717352
NCBI-ProteinID: NP_001319221
MIPS: AT1G53980.1
TAIR: AT1G53980
Araport: AT1G53980
UniProt: Q9SYF4
Position
1
AA seq 91 aa AA seqDB search
MKILIKTEKGKTINLELEDSSETIDIKIHAEPTRQLVLGLGQGPQGEMMSIFVSTLKGKT
FNLEVKGSEIIQQVKNMIHDQVPPVKKQEAN
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcttatcaagacagagaagggaaagaccataaacctagagcttgaggatagc
tccgagacaatcgacatcaagatccatgcagagccgacccgtcaactggttttgggtctg
ggtcagggacctcagggtgaaatgatgagtatttttgtatcaacgcttaaggggaaaaca
ttcaacctagaggtgaagggatctgagatcattcaacaagtcaagaacatgatccatgac
caggtcccaccagtgaagaagcaagaggcaaattga

DBGET integrated database retrieval system