KEGG   Arabidopsis thaliana (thale cress): AT1G54100Help
Entry
AT1G54100         CDS       T00041                                 

Gene name
ALDH7B4
Definition
(RefSeq) aldehyde dehydrogenase 7B4
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00260  Glycine, serine and threonine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G54100 (ALDH7B4)
   00053 Ascorbate and aldarate metabolism
    AT1G54100 (ALDH7B4)
   00620 Pyruvate metabolism
    AT1G54100 (ALDH7B4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G54100 (ALDH7B4)
   00561 Glycerolipid metabolism
    AT1G54100 (ALDH7B4)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G54100 (ALDH7B4)
   00280 Valine, leucine and isoleucine degradation
    AT1G54100 (ALDH7B4)
   00310 Lysine degradation
    AT1G54100 (ALDH7B4)
   00330 Arginine and proline metabolism
    AT1G54100 (ALDH7B4)
   00340 Histidine metabolism
    AT1G54100 (ALDH7B4)
   00380 Tryptophan metabolism
    AT1G54100 (ALDH7B4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G54100 (ALDH7B4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT1G54100 (ALDH7B4)
    1.2.1.8  betaine-aldehyde dehydrogenase
     AT1G54100 (ALDH7B4)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     AT1G54100 (ALDH7B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 841849
NCBI-ProteinID: NP_175812
MIPS: AT1G54100.1
TAIR: AT1G54100
Araport: AT1G54100
UniProt: Q9SYG7 A0A178W3F2
Position
1
AA seq 508 aa AA seqDB search
MGSANNEYEFLSEIGLTSHNLGSYVAGKWQANGPLVSTLNPANNQPIAQVVEASLEDYEQ
GLKACEEAAKIWMQVTAPKRGDIVRQIGDALRSKLDYLGRLLSLEMGKILAEGIGEVQEV
IDMCDFAVGLSRQLNGSVIPSERPNHMMLEMWNPLGIVGVITAFNFPCAVLGWNACIALV
CGNCVVWKGAPTTPLITIAMTKLVAEVLEKNNLPGAIFTAMCGGAEIGEAIAKDTRIPLV
SFTGSSRVGSMVQQTVNARSGKTLLELSGNNAIIVMDDADIQLAARSVLFAAVGTAGQRC
TTCRRLLLHESVYDKVLEQLLTSYKQVKIGNPLEKGTLLGPLHTPESKKNFEKGIEVIKS
QGGKILTGGKAVEGEGNFVEPTIIEISADAAVVKEELFAPVLYVLKFKSFGEAVAINNSV
PQGLSSSIFTRNPENIFRWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSD
SWKQYMRRSTCTINYGNELPLAQGINFG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgaacaacgagtacgagtttctgagtgagattgggctgacttctcacaac
ttgggatcttacgttgctggcaaatggcaagccaacggacctcttgtttcaactctcaat
cctgctaacaatcagccaattgctcaagttgtggaagcttctctagaggattacgagcaa
ggtttgaaagcttgcgaggaagcagctaaaatatggatgcaggttacggctcctaagaga
ggtgatatcgtcagacagattggggatgcactaagatccaaacttgactatcttggtcgt
cttctttctcttgaaatgggaaagatccttgctgaaggtattggagaagttcaggaagta
attgacatgtgtgattttgctgttggtttgagccgacaactcaatggatcggttatacct
tcagaacgccctaaccacatgatgttggagatgtggaatcctcttggcattgttggtgtt
atcacagcgtttaattttccctgtgcagttcttggttggaatgcttgtattgctcttgtc
tgtggaaactgtgtagtctggaaaggtgctccaactacaccgttaataactatcgcaatg
accaagctagtagctgaagttttagagaaaaacaacttacccggtgccatttttacggcc
atgtgtggtggtgctgaaattggtgaagcaatagccaaagacacacgcattcccttagta
tcctttactggaagctccagggtgggctcaatggtacaacaaacagtgaatgcgagatct
gggaaaactttgcttgagttgagtggaaacaatgcaatcatagtcatggacgatgctgat
atacagttagcggctcgatctgttctattcgctgcggttggaactgctggtcaacgttgc
acaacttgccgtaggctgcttttgcatgagagtgtctatgacaaagtactcgagcaactg
cttacctcatacaaacaagtcaaaatcggcaatcctcttgagaaagggacattgttagga
ccattacatactcctgaatcaaaaaagaactttgagaaaggaattgaagtcatcaaatcc
cagggtggtaaaatactaacgggaggtaaagcagtcgaaggtgaaggaaactttgtggag
cctacgataatcgagatatcagcagatgctgctgtcgtcaaagaagagctatttgctccg
gttctatatgttctaaagtttaagtcatttggagaggctgttgcgataaacaactcggtt
cctcaaggtctaagcagctcgatattcactcggaaccctgaaaacatcttcaggtggatc
ggaccactgggaagtgactgtggcattgtgaatgtgaacataccgacgaatggagctgag
attggtggagcttttggaggcgagaaagcgactggtggtggtcgtgaagctggaagcgac
tcatggaaacagtacatgcgtcgatcgacttgtaccatcaactatggaaacgagttacct
ctagcgcaaggaattaacttcggttag

DBGET integrated database retrieval system