KEGG   Arabidopsis thaliana (thale cress): AT1G55050
Entry
AT1G55050         CDS       T00041                                 
Name
(RefSeq) uncharacterized protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: ELM2 Myb_DNA-bind_7
Other DBs
NCBI-GeneID: 841948
NCBI-ProteinID: NP_001117493
TAIR: AT1G55050
UniProt: F4HYN6
Position
1:20541837..20545861
AA seq 915 aa
MMEEENSSMEESCDEEFVCGDPKVDIRVGDEYQVEIPPMMSESQRAELLLNPLEFDSSCS
FAVGLPVEVMWIETKCRDGDGLGSDNIDMNESLKSLKRKRSRRGGSDGNSGSKRRMNLEA
VPEKSSSSWEDLEVDGFVLGLYTFGKNFAQVQKLLESKATGEILLFYYGKFYGSAKYKTW
SNYLKKRSTRCIQGKKLYSDWRLQLLLSRLIRSITDESKEQKLVDVSKSFAEGKKSLEEY
INAVKKLVGLRCLVEAVAIGKDKEDLTVLTTKPVDVEQWFRVSSAVPAGLGEYNSLTVEG
IIEKLSGGSRVSKARCNDIFWDAVWPRLLHRGWRSELPKDQGYIKSKEHIVFLVPGVKKF
SRKKLVKRDHYFDSISDILKKVVSEPELLEETAEEEREENTYNQSKQEKHCYLRSPSSSS
THMKFTVVDTSRFASRGKLYEFRELRIPSLASQSKACRGDNNSSVERFKFADERKCKRKQ
KMEVVDEPMTFLILDTSVDKGGHTSGIRRRRHLPKEAFGESSQNQSGTSKDVNCEYLKGT
DPGVEEETLENVQQGRSKKIKQKFALLSESNKRHLVGSLPLRKRRRLSTCVRKDRKRSGE
SSVLKPPPLDQITNSHPKLHVDSMNLNTNQSEENENIEIQERPETEPNGFCSISETVHEP
SSSAQQQEPNGLRSSKEQGALHDEPISLAQQQEPNGLYSSKEQGAFHEHSSTEQQQDESN
RLCLDKICSSKDLGTAQKEEQPIQLPPKSASDKNSPSRDHGTTEERASLEQQEEEHKQQA
NTDIPRRQSTRKRPLTTRALEALESDFFTPKSKKTTTSKPRNRERSARIKHSANANNKTP
GESDNSFHVKEAITSKPSDQIKDSEPSFLVDKVTVTSSKHVEQIKDSEKVTTEFPKLPPI
VLKLPFRRGSRSNED
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgatggaagaagaaaacagttctatggaagagtcttgtgatgaagaattcgtttgtgga
gatccaaaagttgatattcgtgttggagatgagtatcaggttgagatacctcctatgatg
tctgaatcccaacgtgcagagcttcttttgaatcctctggaatttgattcctcttgttct
tttgctgtgggactacctgttgaagtaatgtggatcgagacaaaatgtagagatggagat
ggacttggaagtgataacattgacatgaacgaatctctcaaatctcttaaaagaaaaaga
agtcgcagaggtgggagtgacgggaactcgggttctaagcgacgtatgaatcttgaagct
gtgcctgagaaatcgtccagttcttgggaagatttggaagtagatgggtttgttcttgga
ctgtatacatttgggaagaactttgctcaggtgcagaagttgttagagagcaaagcaaca
ggagagatacttttgttttactatggaaagttttatggttctgctaaatacaaaacttgg
tctaattatcttaagaagcggagtacgagatgtatacaagggaagaagctctattcagat
tggaggctacagctgttgttgtcccgtttaattcgcagcattaccgatgaatcgaaagaa
cagaagctagtggatgtctcaaagtcatttgctgaagggaagaaatctctggaggaatac
atcaacgcggttaagaaactagtgggtcttcggtgtcttgtagaggctgtagcaatcggt
aaagataaggaagatctgacagtccttacaacaaaacccgtagatgtagaacaatggttt
agagtttcttctgcggtacctgctggtttaggggaatacaattcactcacagttgaaggt
ataatcgaaaaattgtctggtggttcccgtgtgagcaaagctcgttgcaatgatatcttc
tgggatgctgtatggccgcgtttgctacataggggttggcgttctgagctgccaaaggac
caaggttacatcaagtctaaagaacacattgtcttcctcgtccctggggtaaagaagttt
tcaagaaagaaacttgtgaaacgtgatcattactttgattctatcagtgacattctcaaa
aaggttgtttcagagcctgagcttcttgaggagacagcagaagaagaaagagaagagaac
acttacaaccaatcaaaacaggagaaacactgttacctcaggtctccaagctcttcttct
actcatatgaagttcactgttgtggacactagtcgttttgcttcaagaggaaagttgtac
gaatttcgggagttgaggattccaagtttagcttctcaatcaaaggcttgtcgaggggat
aacaactcttctgtggaaagattcaagtttgctgatgaacgtaagtgtaaaaggaagcaa
aagatggaagtggtggatgaaccgatgacattcttgattctggatacaagtgtggacaaa
ggtgggcatacatctgggataagaagacggagacatttgcctaaagaggcatttggtgaa
tcatcacagaaccaatctggcactagtaaagatgtgaactgcgagtatcttaaggggact
gatcctggtgtagaggaagagactttggagaatgtccaacaaggtcggtcaaagaagatt
aagcagaagtttgccctattatcagaatctaataaacgtcatttggttggttctcttccc
ttgcgaaaacgtaggcggctcagtacttgtgtaaggaaagatagaaaacgttctggtgaa
agttcagtgttgaagccacctccattagaccagataactaacagccaccccaagttacat
gttgattctatgaacctcaacactaaccagtcagaagaaaatgaaaatattgagattcaa
gaaaggccagaaactgaaccaaatggcttttgttccatctcggagacagttcatgaacca
agttcatcagcacaacaacaagaaccaaatgggttacgttcatcaaaggaacaaggagct
cttcatgatgaaccaatttcactagcacaacaacaagaaccaaatgggttatattcatca
aaagaacaaggagcttttcatgaacacagttcaacagaacaacaacaagacgaatcaaat
cggttgtgtttggacaaaatatgctcttccaaggatctgggaactgctcaaaaagaagag
caaccgattcagttgcctcctaagtcagcctcagacaagaattctccgtccagagatcat
ggaactactgaagaacgtgcatcattagaacaacaagaagaagagcataaacaacaggcc
aacacggacattccaagaagacaaagcacaagaaagcggccgttgactactcgtgctctg
gaagctctagaatcggacttttttacaccaaaaagcaagaaaactactacatctaaaccg
agaaaccgcgaacgttctgcaaggatcaagcactcagccaatgcgaataacaaaactcca
ggcgagtcagacaatagttttcatgtaaaggaggcgataacaagtaaaccgtcagaccaa
ataaaggattccgaaccgagctttcttgtggataaagtaacggtgacaagtagtaagcat
gtggaacaaataaaggattcggagaaggtgactaccgagttccctaaacttcctccaatt
gttttgaaacttccctttaggcgtggctcaagaagcaatgaagactga

DBGET integrated database retrieval system