KEGG   Arabidopsis thaliana (thale cress): AT1G55350
Entry
AT1G55350         CDS       T00041                                 

Gene name
DEK1
Definition
(RefSeq) calpain-type cysteine protease family
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III Laminin_G_3 Laminin_G_2
Other DBs
NCBI-GeneID: 841981
NCBI-ProteinID: NP_001319240
MIPS: AT1G55350.1
TAIR: AT1G55350
Araport: AT1G55350
UniProt: Q8RVL2 A0A5S9WQ51
Position
1
AA seq 2151 aa
MEGDERGVLLACVISGTLFTVFGSGSFWILWAVNWRPWRLYSWIFARKWPKVLQGPQLDI
LCGVLSLFAWIVVVSPIAILIGWGSWLIVILDRHIIGLAIIMAGTALLLAFYSIMLWWRT
QWQSSRAVALLLLLGVALLCAYELCAVYVTAGAHASQQYSPSGFFFGVSAIALAINMLFI
CRMVFNGNGLDVDEYVRRAYKFAYSDCIEVGPVACLPEPPDPNELYPRQTSRASHLGLLY
LGSLVVLLAYSVLYGLTARESRWLGGITSAAVIVLDWNIGACLYGFKLLQNRVLALFVAG
ISRLFLICFGIHYWYLGHCISYIFVASVLSGAAVSRHLSITDPSAARRDALQSTVIRLRE
GFRRKEQNSSSSSSDGCGSSIKRSSSIDAGHTGCTNEANRTAESCTADNLTRTGSSQEGI
NSDKSEESGRPSLGLRSSSCRSVVQEPEAGTSYFMDKVSDQNNTLVVCSSSGLDSQGYES
STSNSANQQLLDMNLALAFQDQLNNPRIASILKKKAKEGDLELTNLLQDKGLDPNFAVML
KEKNLDPTILALLQRSSLDADRDHRDNTDITIIDSNSVDNTLPNQISLSEELRLRGLEKW
LKLSRLLLHHVAGTPERAWGLFSLVFILETIIVAIFRPKTITIINSSHQQFEFGFSVLLL
SPVVCSIMAFLRSLQVEEMALTSKSRKYGFVAWLLSTSVGLSLSFLSKSSVLLGISLTVP
LMAACLSIAVPIWMHNGYQFWVPQLSCGDQARDLRSPRIKGFILWICVVLFAGSVISLGA
IISAKPLDDLKYKLFSARENNVTSPYTSSVYLGWAMSSGIALVVTAILPIVSWFATYRFS
HSSAVCLMIFSVVLVAFCGTSYLEVVKSRDDQLPTKGDFLAALLPLACIPALLSLCCGMV
KWKDDCWILSRGVYVFFSIGLLLLFGAIAAVIAVKPWTIGVSFLLVLFLMVVTIGVIHLW
ASNNFYLTRKQTSFVCFLALLLGLAAFLLGWHQDKAFAGASVGYFTFLSLLAGRALAVLL
SPPIVVYSPRVLPVYVYDAHADCGKNVSAAFLVLYGIALATEGWGVVASLIIYPPFAGAA
VSAITLVVAFGFAVSRPCLTLEMMEVAVRFLSKDTIVQAISRSATKTRNALSGTYSAPQR
SASSAALLVGDPSAMRDKAGNFVLPRDDVMKLRDRLRNEERVAGSIFYKMQCRKGFRHEP
PTNVDYRRDMCAHARVLALEEAIDTEWVYMWDKFGGYLLLLLGLTAKAERVQDEVRLRLF
LDSIGFSDLSARKISKWKPEDRRQFEIIQESYLREKEMEEESLMQRREEEGRGKERRKAL
LEKEERKWKEIEASLIPSIPNAGSREAAAMAAAIRAVGGDSVLEDSFARERVSGIARRIR
TAQLERRAQQTGISGAVCVLDDEPMISGKHCGQMDSSVCQSQKISFSVTAMIQSDSGPVC
LFGTEFQKKVCWEILVAGSEQGIEAGQVGLRLITKGERQTTVAREWYIGATSITDGRWHT
VTITIDADAGEATCYIDGGFDGYQNGLPLSIGSAIWEQGAEVWLGVRPPIDVDAFGRSDS
DGVESKMHIMDVFLWGKCLSEEEAASLHAAIGMADLDMIDLSDDNWQWTDSPPRVDGWDS
DPADVDLYDRDDVDWDGQYSSGRKRRSGRDFVMSVDSFARRHRKPRMETQEDINQRMRSV
ELAVKEALSARGDKQFTDQEFPPNDRSLFVDTQNPPSKLQVVSEWMRPDSIVKENGSDSR
PCLFSGDANPSDVCQGRLGDCWFLSAVAVLTEVSRISEVIITPEYNEEGIYTVRFCIQGE
WVPVVIDDWIPCESPGKPAFATSRKLNELWVSMVEKAYAKLHGSYEALEGGLVQDALVDL
TGGAGEEIDLRSAQAQIDLASGRLWSQLLRFKQEGFLLGAGSPSGSDVHVSSSGIVQGHA
YSVLQVREVDGHRLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHKLKHVPQSKEGIFWMS
WQDFQIHFRSIYVCRVYPREMRYSVNGQWRGYSAGGCQDYSSWHQNPQFRLRATGSDASL
PIHVFITLTQGVGFSRTTPGFRNYQSSHDSQLFYIGLRILKTRGRRAAYNIFLHESVGGT
DYVNSREISCEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL
NT seq 6456 nt   +upstreamnt  +downstreamnt
atggaaggggatgagcgaggagtcttacttgcttgtgtaatttcgggtacccttttcacg
gttttcggttcgggttcgttttggatactttgggctgttaattggcggccatggcgtctc
tacagttggatctttgctagaaaatggccaaaagtattgcaaggtcctcagcttgatata
ctatgtggtgttctatctctttttgcttggattgtggtagtatcccctattgcaatcttg
ataggatggggttcttggctgattgtgatattggatcgacatatcattgggctggcgata
ataatggctggaacagcccttttactggcattctactcaatcatgctttggtggaggacc
cagtggcaaagctcaagagctgtcgctttacttctccttcttggtgttgccttactatgt
gcgtatgaactctgtgctgtctatgttacggctggtgcgcatgcatctcagcaatattct
ccttctggtttctttttcggtgtatcagcaatcgcgttggcaattaacatgctatttatc
tgccgcatggtctttaatggaaatggtttagatgtggacgaatatgtaaggagggcatat
aaatttgcttattcagattgtatagaagtgggtcctgtggcttgtttgcctgaacctcct
gatcctaatgaattatatccccggcaaaccagcagggcttcacatcttggccttctgtac
ctgggctcactcgtagttctccttgcctactcagtcctatatggtctcacagctagggaa
tcacgttggcttggaggaatcacatcagctgcagttattgttcttgactggaatattggg
gcatgcttgtatgggtttaagcttcttcagaatcgtgttctggcactttttgttgctggc
atatcccgtcttttcctaatatgttttggcatacactactggtacctagggcattgtatt
agttacattttcgtagcatcagttctatcaggtgctgctgtttctcggcatctatctata
acagacccatcagctgcaagaagagatgccttacagagcacagtgatccgcttgagagaa
ggttttcggagaaaagagcagaatagttcttcaagttcttcagatggttgtggctcaagt
ataaaaagaagtagtagtatcgatgctggccatactggttgtactaatgaagcaaatcgt
acggcagaatcttgcacggctgacaatctaactcgaacaggcagctctcaggagggaatc
aatagcgacaaaagcgaagaaagtggaagaccaagcttaggtttacgtagtagttcatgt
cgttctgtggtccaagagcccgaagcaggaacgtcttattttatggacaaagtttctgat
caaaataacactcttgttgtttgttcgagcagtggtctagatagccaaggttacgagtct
agcacatcgaattctgcaaaccagcagcttttggatatgaatttggctcttgctttccag
gaccagttaaacaatcctaggatagcctcgatacttaagaagaaagcaaaagaaggtgat
cttgaactgactaatttgctgcaagacaaggggttggaccctaactttgctgtaatgttg
aaggaaaaaaacttggatcctactatattggcactacttcagaggagtagtttggatgca
gatagagatcaccgcgacaatactgatattacaatcattgactcaaacagtgttgacaat
actttgccaaatcagatttctttatccgaagaattgagactccgtggactagagaagtgg
cttaagttgtctagacttcttctgcaccatgtagcggggacaccagagagagcatggggc
ctctttagtcttgtctttatccttgaaacaatcattgtggccatttttcgcccaaagacc
atcacgattataaattctagtcatcaacagttcgaatttggtttctctgtgctgctattg
tcacctgttgtctgttcaataatggcttttcttcggtctcttcaagttgaggaaatggcc
ttgacatcaaaatctcgcaagtatggctttgttgcctggcttctgagcacatcagttgga
ttgtcactctcgttcttgagtaaatcgtcagtacttctgggaatatccttgactgtgccc
ctcatggcagcatgcctgtctattgctgttcccatatggatgcataatgggtaccaattt
tgggttccacagttatcatgtggtgaccaggcaagagatttacgatctcccaggataaag
gggtttattctttggatttgtgttgtgttgtttgcgggttctgtaatttctcttggtgcg
attatatctgctaaacctttggatgatttaaagtataagctgtttagtgccagagaaaac
aacgtcacgtcaccatatacatcttctgtataccttggttgggcaatgtcatctggaatt
gctttagtagttaccgccattctaccaatagtttcatggtttgcaacttataggttttcc
cactcttctgctgtctgtctcatgatattctcagttgttctcgtggcattttgtggaact
tcatatttggaagttgtaaaatctagagatgatcagttgcccacaaagggtgatttcctt
gcggccttgcttccacttgcatgcattccggcgctgctttcactatgctgtgggatggtt
aaatggaaggacgattgttggatactctctcgaggtgtatatgttttcttttcaataggt
cttcttcttctttttggtgcgatagcagctgtcattgcagtcaaaccatggacgataggc
gtatcttttctcttagttcttttccttatggtggtaacaattggtgtaatccatctttgg
gcgtcaaacaatttctatttaaccaggaaacagacatcctttgtctgctttcttgctctt
cttttgggtttggccgcattccttctcggatggcatcaagataaagcatttgctggagca
tctgttggttactttacattcctgtctctgttggctggaagagcattagctgttcttcta
tccccaccaattgtagtatattctccaagggtgctaccagtatatgtctacgatgctcat
gctgattgcggaaagaatgtcagtgctgcatttcttgtcctgtatggaattgctttggca
acagaaggctggggtgttgttgctagtctgataatttatcctccgtttgcgggtgctgct
gtatcagctatcacccttgtagtagcctttgggtttgctgtttctcgcccatgtttgact
cttgagatgatggaggttgctgtacgctttcttagcaaggatactatagtgcaagctatc
tctcgatctgccacgaaaacaagaaatgctctatccggcacgtattcagctccccaaagg
tccgccagctctgcagctcttctggttggggatccctctgcaatgcgtgataaagcaggg
aactttgtgcttcctagagatgatgtcatgaaattaagggatcgtctcaggaacgaagaa
agagttgctggatcaatcttctacaaaatgcaatgcaggaaaggattccgtcatgaacca
cctacaaatgtagattatagaagagacatgtgtgcccatgcaagagttttggcactggaa
gaggcaattgatacagaatgggtgtatatgtgggacaaatttggtggttatttactacta
ttgttaggtttgacagctaaggcggagagagttcaggatgaggtacggttgcggctcttc
ttagatagcattgggttctcggatttaagtgccagaaaaatcagtaaatggaagccagag
gatagaagacaattcgaaattattcaagagagttatctgagagagaaagagatggaagag
gaaagccttatgcagagacgtgaagaagaagggagaggtaaagaaagaaggaaagctctt
ttggagaaggaagagcgcaaatggaaggaaattgaagcgtcccttattccatctattcct
aatgctggtagcagggaggcagcagccatggcagctgcaatacgtgctgttgggggtgat
tctgtccttgaggattccttcgcaagagagagggtctcgggtattgcacgtaggatacgc
actgctcaactagaacgacgtgcacaacagactggaatatctggggcagtttgtgttctt
gatgatgaaccaatgataagtggtaaacattgcggccaaatggactcaagtgtctgtcaa
agtcagaagattagcttttccgttacagcaatgatccaatccgattctggacctgtatgt
ctttttggcactgaatttcaaaagaaagtatgttgggagattctggttgctggttctgag
caaggaattgaggctggccaagttgggcttaggttgataacaaaaggtgagaggcagaca
accgttgctagagagtggtatattggtgcaaccagcataactgatggaaggtggcataca
gtgacaatcacaattgatgctgatgcgggggaagctacttgttacatagatggtgggttt
gatggctaccagaatgggttacctctaagtattggcagtgccatttgggaacaaggagct
gaagtttggttgggtgttaggccacctatagatgttgatgcattcgggagatcagatagt
gatggcgtcgaatcaaagatgcatattatggatgttttcctttgggggaaatgcttaagt
gaagaagaggccgcttctttgcatgcagccattggcatggctgacttagacatgattgat
ttgtctgatgacaattggcaatggacggattcaccccccagagtcgatggttgggatagt
gatcctgccgatgttgatctctatgatagggatgacgtagattgggatggacaatattcc
agtgggaggaaaagaagatcaggtcgggattttgtaatgagtgtcgattcctttgccagg
agacacaggaaacccaggatggagacacaagaagatataaatcaaagaatgcgttcagtt
gagttggctgtcaaagaagctctctctgcacgaggtgataagcaatttactgaccaggaa
tttcctccaaatgatcgctctttatttgtggatacacaaaatcccccatcaaaattgcag
gttgtttctgaatggatgagacctgactccattgtgaaagaaaacggtagtgattcccgt
ccctgcctgttctctggggatgcaaatccttcagatgtttgccaggggcgtttgggggat
tgttggttcttaagcgccgttgcagttttgacagaggtttcacgaatatctgaagtgatc
attactcctgaatacaacgaggaagggatctacactgttcgtttttgtattcagggtgag
tgggttcctgttgttatcgatgactggattccatgtgaatcacctggtaaaccagctttt
gctactagcagaaagctcaatgaactctgggtctccatggtggagaaagcatatgccaag
ctccatggttcttatgaggcactggaggggggactggttcaggatgctcttgtcgaccta
actggaggagctggtgaggagattgacttgcggagtgctcaagcacaaatagatcttgca
agtggcagattgtggtctcaattgttacgttttaaacaagaggggttcttacttggtgct
ggaagtccatcaggatctgatgttcatgtatcttccagtggcattgtgcaagggcatgct
tactccgtcttacaggtgagagaggttgatgggcacagacttgttcagattcgaaatcca
tgggctaatgaagttgagtggaatggtccctggtcagactcatccccagagtggactgat
aggatgaagcacaagctgaagcatgttccacagtcaaaagaaggtatattctggatgtct
tggcaagatttccagattcatttcagatcaatatatgtgtgtcgggtttacccccgtgag
atgcgctactctgtaaatggccaatggcgaggttatagtgccggtggctgccaagattat
agctcatggcatcaaaatccacaattcaggctgagggcaactggttctgatgcatcttta
ccaattcatgtgttcatcaccttaactcagggcgtaggtttctcgagaacaactcctgga
tttcgtaactaccaatcaagccatgattcacagttgttctatatcggattgaggattctt
aaaactcgtggacgtcgtgctgcttacaacatatttcttcatgaatctgttggtggaaca
gactatgtgaattcccgtgagatttcatgtgaaatggttcttgaccctgatcctaagggt
tatactattgtcccaaccacgatacacccaggggaagaagcaccttttgtcctttcagtc
ttcacaaaagcatccattgttcttgaagctttgtag

DBGET integrated database retrieval system