KEGG   Arabidopsis thaliana (thale cress): AT1G55670Help
Entry
AT1G55670         CDS       T00041                                 

Gene name
PSAG
Definition
(RefSeq) photosystem I subunit G
  KO
K08905  photosystem I subunit V
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00195  Photosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    AT1G55670 (PSAG)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Other subunits in plants
    AT1G55670 (PSAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSI_PSAK DUF3778
Motif
Other DBs
NCBI-GeneID: 842016
NCBI-ProteinID: NP_175963
MIPS: AT1G55670.1
TAIR: AT1G55670
Araport: AT1G55670
UniProt: Q9S7N7
Position
1
AA seq 160 aa AA seqDB search
MATSASALLSPTTFSTAISHKNPNSISFHGLRPLRLGGSSSALPKLSTTGRKSSSAVVRA
ELSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDRAKEYVSLLK
SNDPIGFNIVDVLAWGSIGHIVAYYILATSSNGYDPSFFG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggccacaagcgcatcagctttgctctcaccaaccacattctccactgcaatctcccac
aaaaaccctaactccatctcattccatggccttcgtcccctccgtctaggtggctcctcc
tccgccctacccaaactatcaaccaccgggagaaaatcctcctccgctgtcgtgagagct
gagctaagcccttccatcgtcataagtctcagcacaggtctctccctcttcctcggccgt
ttcgtcttcttcaacttccagagagagaacgtagcaaaacagggcttaccggagcagaac
ggaaaaacccatttcgaagctggagatgatcgtgctaaggagtacgtcagtctcttgaaa
tcgaacgatccaattggattcaacattgttgatgttcttgcttggggttctattggacac
atcgttgcttactacatcttggctacttccagcaatggatacgacccaagcttctttgga
tga

DBGET integrated database retrieval system