KEGG   Arabidopsis thaliana (thale cress): AT1G55860
Entry
AT1G55860         CDS       T00041                                 
Symbol
UPL1
Name
(RefSeq) LOW protein: E3 ubiquitin ligase-like protein
  KO
K10592  E3 ubiquitin-protein ligase HUWE1 [EC:2.3.2.26]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT1G55860 (UPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT1G55860 (UPL1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     AT1G55860 (UPL1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  HECT type E3
   AT1G55860 (UPL1)
SSDB
Motif
Pfam: HECT DUF913 DUF908 UBM UBA UIM DUF4636
Other DBs
NCBI-GeneID: 842036
NCBI-ProteinID: NP_001185245
TAIR: AT1G55860
UniProt: Q8GY23
Position
1:complement(20879900..20893268)
AA seq 3681 aa
MKLRRRRASEVPSKIKSFINSVTSVPLELIHEPLACFRWEFDKGDFHHWVDLFNYFDTFF
EKHVQVRKDLHIEENFEESDPPFPKDAVLQVLRVIRVVLENCTNKHFYSSYEQHLSLLLA
STDADVVEACLQTLAAFLKRQIGKYSIRDASLNSKLFSLAQGWGGKEEGLGLTSCAAENS
CDQVSLQLGRTLHFEFYPSDESPSELPGGLQVIHVPDVSICAESDLELLNKLVIDHNVPP
SLRFALLTRMRFARAFSSLATRQQFTCIRLYAFVVLVQASGDTENVVSFFNGEPEFVNEL
VTLVSYEDTVPEKIRILCLLSLVALSQDRTRQPTVLTAVTSGGHRGLLSGLMQKAIDSVV
CITSKWSLAFAEALLSLVTVLVSSSSGCSAMREAGLIPTLVPLIKDTDPQHLHLVSAAVH
ILEAFMDYSNPAAALFRDLGGLDDTIFRLKLEVSRTEDDVKEKNCSSDSNGPDTEQLPYS
EALISYHRRLLLKALLRAISLGTYAPGNTNLYGSEESLLPECLCIIFRRAKDFGGGVFSL
AATVMSDLIHKDPTCFNALDSAGLTSTFLDAISDEVICSAEAITCIPQCLDALCLNNSGL
QAVKDRNALRCFVKIFTSPSYLRALTGDTPGSLSSGLDELLRHQSSLRTYGVDMFIEILN
SMLIIGSGMEATTSKSADVPTSAAPVPMEIDVDEKSLAVSDEAEPSSDTSPANIELFLPD
CVCNVARLFETVLQNAEVCSLFVEKKGIDAVLQLFSLPLMPLSTSLGQSFSVAFKNFSPQ
HSAGLARIVCSYLREHLKKTKILLVSIEGTQLLKLESAIQTKILRSLSCLEGMLSLSNFL
LKGSASVISELSAADADVLKELGITYKQTIWQMALCNDTKEDEKKSVDRGSDNSVSASSS
TAERESDEDSSNALAVRYTNPVSIRSSSSQSIWGGDREFLSIVRSGEGIHGRTRHAIARM
RGGRTRRHLESFNFDSEIPADLPVTSSSHELKKKSTEVLIAEILNKLNCTLRFFFTALVK
GFTSANRRRIDGASLSSASKTLGTALAKVFLEALNFDGYGAAAGHEKSLSVKCRYLGKVV
DDITFLSFDTRRRVCFTAMVNSFYVHGTFKELLTTFEATSQLLWTVPFSIPASSTENEKP
GERNIWSHSKWLVDTLQNYCRALDYFVNSTYLLSPTSQTQLLVQPASVGLSIGLFPVPRE
PETFVRNLQSQVLDVILPIWNHPMFPDCNPNFVASVTSLVTHIYSGVVDARENRSGVTRG
INQRALPLQLDESIVGMIVEMGFSRSRAEIALRRVGTNSVEMAMDWLFTNPEQPVQEDDE
LAQALALSLGNSSETPKLEDTEKPVDVPQEEAEPKEPPVDEVIAASVKLFQSDDSMAFPL
MDLFVTLCNRNKGEDRPKIVSYLIQQLKLVQLDFSKDTGALTMIPHILALVLSEDDNTRE
IAAQDGIVTVAIGILTDFNLKSESETEILAPKCISALLLVLSMMLQAQTKLSSEYVEGNQ
GGSLVPSDSPQDSTAALKDALSSDVAKGESNQALELIFGKSTGYLTMEEGHKALLIACGL
IKQHVPAMIMQAVLQLCARLTKSHALAIQFLENGGLSSLFNLPKKCCFPGYDTVASVIVR
HLVEDPQTLQIAMETEIRQTLSGKRHIGRVLPRTFLTTMAPVISRDPVVFMKAVASTCQL
ESSGGRDFVILSKEKEKPKVSGSEHGFSLNEPLGISENKLHDVSGKCSKSHRRVPANFIQ
VIDQLIDLVLSFPRVKRQEDGETNLISMEVDEPTTKVKGKSKVGEPEKASSSRVGEPEKA
EIPEKSEELARVTFILKLLSDIVLMYSHGTSVILRRDTEISQLRGSNLPDDSPGNGGLIY
HVIHRLLPISLEKFVGPEEWKEKLSEKASWFLVVLCSRSNEGRKRIINELSRVLSVFASL
GRSSSKSVLLPDKRVLAFANLVYSILTKNSSSSSSNFPGCGCSPDVAKSMMDGGTIQCLT
SILHVIDLDHPDAPKLVTLILKSLETLTRAANAAEQLKSEVPNEKKNRDSDERHDSHGNS
TETEADELNQNNSSLQQVTDAAGNGQEQAQVSSQSAGERGSSQTQAMPQDMRIEGDETIL
PEPIQMDFMREEIEGDQIEMSFHVENRADDDVDDDMGDEGEDDEGDDEDADLVEDGAGVM
SLAGTDVEDPEDTGLGDEYNDDMVDEDDDDFHENRVIEVRWREALDGLDHFQILGRSGGG
NGFIDDITAEPFEGVNVDDLFALRRPLGFERRRQTGRSSLDRSGSEVHGFQHPLFSRPSQ
TGNTASVSASAGSISRHSEAGSYDVAQFYMFDTPVLPFDQVPVDPFSARLAGGGAPPPLT
DYSVVGMDSSRRGVGDSRWTDIGHPQPSSLSASIAQLIEEHFISNLRASAPVNTVVERET
NTTEIQEQLHPDVPPSVGSETVLGDGNEGGQQSEERELLNNNENVNNPPDVMAESFAQGQ
ANLASPVSQDTGESLQQLEVMQPLPLNSTPNEIDRMEVGEGDGAPIDQVDHEAVHLISTA
QGQPDTSSIQNVSVTAIAPPVDDPDSNFQPSVDVDMSSDGAEGNQSVQPSPLDGDNNELS
SMEATENVRNDEQVEEGSLDGRAPEVNAIDPTFLEALPEDLRAEVLASQQAQSVQPPTYE
PPPVDDIDPEFLAALPPDIQTEVLAQQRAQRMVQQSQGQAVDMDNASIIATLPADLREEV
LLTSSEAVLAALPSPLLAEAQMLRDRAMSHYQARSSVFGSSHRLNNRRNGLGYNRLTGMD
RGVGVTIGQRAVSSSADGLKVKEIEGDPLVNADALKSLIRLLRLAQPLGKGLLQRLLLNL
CAHSFTRANLVQLLLDMIRPEMETSPSELAITNPQRLYGCQSNVVYGRSQLLNGLPPLVF
RRVLEVLTYLATNHSAVADMLFYFDSSLLSQLSSRKGKEKVTHVTDSRDLEIPLVVFLKL
LNRPQLLQSTSHLGLVMGLLQVVVYTAASRIEGWSPSSGVPEKLENKPVGEEASSETRKD
AESELVGEADLSVARRKNCAEIYNIFLQLPQSDLCNLCILLGYEGLSDKIYSLAGEVLKK
LAAVDVAHRKFFTKELSELASSLSSSTVRELATLSSKQKMSRSTGSMAGASILRVLQVLS
SLTSPIDESNVGTERETEQEEQNIMQRLNVALEPLWHELSQCISMTELQLDHTAAASNIN
PGDHVLGISPTSSLSPGTQRLLPLIEAFFVLCEKIQTPSMLQQDTNVTAGEVKESSAHGS
SSKTSVDSQKKTDGSVTFSKFAEKHRRLLNSFIRQNPSLLEKSLSMMLKAPRLIDFDNKK
AYFRSRIRHQHDQHISGPLRISVRRAYVLEDSYNQLRMRSPQDLKGRLNVQFQGEEGIDA
GGLTREWYQLLSRVIFDKGALLFTTVGNDATFQPNPNSVYQTEHLSYFKFVGRMVAKALF
DGQLLDVYFTRSFYKHILGVKVTYHDIEAVDPDYYKNLKWLLENDVSDILDLTFSMDADE
EKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVAGHILTNAIRPQINAFLEGFNEL
IPRELVSIFNDKELELLISGLPEIDFDDLKANTEYTSYTAGSPVIHWFWEVVKAFSKEDM
ARFLQFVTGTSKVPLEGFKALQGISGPQRLQIHKAYGAPERLPSAHTCFNQLDLPEYQSK
EQLQERLLLAIHEASEGFGFA
NT seq 11046 nt   +upstreamnt  +downstreamnt
atgaagcttagaaggagaagagcttcggaagtgccttcgaaaatcaaatcgttcatcaat
agtgttacttctgttccactcgagctaatacatgaaccccttgcatgttttcgctgggaa
ttcgacaagggtgacttccatcattgggtggacctcttcaattattttgacacatttttc
gagaagcacgtccaagtaaggaaggatttgcatattgaggaaaactttgaggagtctgat
ccacctttccctaaggatgctgttctgcaagttctccgagttatcagagttgttttagag
aattgcacgaacaaacatttttacagttcttatgagcagcatctttctctcctacttgca
tctactgatgcagatgtcgttgaagcgtgtctgcagacgttggctgcctttttgaaaagg
caaattggaaaatactcaataagagatgcttccctgaattcaaaactattttcccttgca
caaggctggggggggaaagaggaaggccttggcttgacgtcatgtgccgcagaaaacagt
tgtgaccaggtttctctccagctaggtcgtactcttcattttgaattttatccttctgat
gaatcaccaagtgagcttcctggcggtttacaagttattcatgtacctgatgtcagcata
tgcgcagagtctgacctggaacttctgaacaaattagtcattgatcacaatgttcctccc
agtttaagatttgcgttgctgaccagaatgagatttgcaagggcgttctcctctttggca
acccggcagcagtttacatgcattcgcttatatgctttcgttgttttggttcaagcaagt
ggtgacactgagaatgttgtttctttctttaatggcgaaccggaatttgtaaatgagtta
gttacgctggtaagctatgaggatactgttccagagaaaataaggatactatgcttgcta
tccttggttgcactatcgcaggatcgaactcggcagccgactgttttaactgcagttacc
tctggcgggcatcgtggtttgctatctggcttaatgcagaaagccattgattctgttgtt
tgtattacttccaagtggtctcttgcttttgcggaagccttgttatcccttgtgacagtc
ctggtttcatcatcgtctggatgttcagccatgcgagaagctggtcttatcccgacccta
gtgcctctcatcaaagatacagatccccagcacttgcatttggtcagtgccgctgtgcat
atattagaagccttcatggattacagcaatccagctgctgctttgttcagagatttgggt
ggcttggatgatactatctttcggttgaaactggaagtctctcgtactgaagacgatgtg
aaagaaaaaaattgcagttctgatagcaatgggcctgatactgaacaacttccctattcg
gaagcattgatttcgtatcacaggagattgttgttaaaagcgttgttacgtgcaatatcc
cttggaacttatgctcctggtaacactaacctctatggttccgaggagagcttgttgcct
gaatgcttatgcattatcttccgaagagcaaaagatttcgggggtggagtattctcgctt
gctgccactgtcatgagtgatctcattcataaagatcccacttgtttcaatgctttagat
tcagctggtttaacttctacctttcttgatgctatatctgatgaggtcatctgctctgca
gaagccataacatgcataccgcagtgtctggatgctctgtgtctcaacaatagcggtctt
caagctgtgaaggaccgaaatgccttgaggtgttttgtgaaaatatttacttctccctct
tatctgagggctcttacaggtgatacacctggttctttgtcaagtgggcttgatgaactc
ttgagacatcaatcttcgttgcgcacttatggagttgatatgttcattgaaatcctcaat
tccatgttgattattggatctgggatggaggccaccacctctaagtcagctgatgtgcct
actagtgctgcacctgttcctatggaaattgacgttgatgagaagagcttggcagtttcg
gatgaggcggaaccatcttctgacacttctccagcaaacattgagctgtttcttccagat
tgtgtgtgtaatgttgctcgtctctttgaaacagttcttcagaatgcggaagtatgttcc
ctgtttgttgagaagaaaggaattgatgcagttttacagctattctctttacctcttatg
cctctatcaacctctcttggtcaaagtttttctgtcgcttttaagaacttctcccctcag
cattcagctggtctagcccggatagtgtgctcctacttaagagaacatctgaagaagaca
aaaatccttttggtttccattgaaggtactcagcttcttaaattagagtctgcaatccag
acgaagattttgagatctctttcctgcctagaaggcatgttgtccctctccaactttttg
ttgaaaggatcagcttcagttatctcagaattgagtgctgctgacgctgatgtactgaaa
gaacttggtataacatacaagcaaacgatttggcagatggccttgtgtaatgatactaag
gaagatgaaaaaaagagtgttgatcgaggatctgataattcagtttcagcttcatccagt
actgctgaaagagagagtgatgaggattcaagcaatgctttagcagttagatacacaaac
cctgtttccattaggagcagtagttctcagtctatttggggtggggatcgcgaatttctg
tctattgtgcgttctggcgaaggtattcatggtcgtacgcgacatgcaatagcccgaatg
aggggtgggagaactcgtcggcacctggagtcttttaattttgattctgaaattccagct
gatctaccagtaacgtcatcttcccatgagctgaaaaagaaaagcactgaagttctcatt
gccgaaattttaaacaagttgaattgtacactacgtttttttttcacagcccttgtgaaa
ggatttacctctgctaatcgtcgcaggattgatggggcatcattgagttcagcatctaag
acgcttggtactgcgttagctaaagtatttcttgaagctcttaacttcgacgggtatggt
gctgctgctgggcatgagaaatctctgtcagtgaagtgccggtaccttggaaaagtggta
gatgatatcactttcctttcatttgatactcgaaggagggtctgttttacagctatggtg
aatagtttttatgtccatggaacgtttaaggaacttctcaccacatttgaagctacaagt
cagttgctttggacagtgccgttttctattcctgcatctagtactgagaatgagaagcca
ggtgagagaaatatatggtctcacagtaagtggctggtagatactctgcaaaactattgc
cgagcgctggactattttgttaactcaacgtatcttttatctccaacctctcaaacgcag
cttcttgtgcagccagcctcagttggtttgtcgattggactttttcctgtaccaagggaa
cctgagacatttgtgcgaaatctgcagtctcaggttctggatgtcatacttcctatatgg
aaccaccctatgtttccagattgcaatcctaattttgttgcttcagttacctcccttgtt
acacatatatactctggtgttgtggatgcaagggaaaatcgaagtggtgttacccggggt
ataaaccaaagagccttgcctctacagcttgacgaatccattgttggtatgattgttgaa
atgggtttttcaaggtcaagggctgaaatcgcgttacgaagagtgggaacaaacagtgtt
gaaatggctatggactggttgtttaccaatcctgagcagccggtgcaggaagatgacgaa
ttggctcaagcacttgcactatctcttggaaattcatctgaaactccaaaacttgaggat
acagaaaagccagtagatgttccgcaggaagaagcagagccaaaagaaccacctgttgat
gaagtcattgctgcatcggtaaagttatttcagagtgatgattctatggctttcccgtta
atggatttgtttgtgacactatgtaaccgaaacaaaggggaagatcggccaaaaatcgtg
tcgtatcttattcagcaactgaagcttgtacaacttgatttctccaaggatactggtgct
ttgactatgataccacacattttagcattagtactctcagaagatgataacacacgagaa
attgctgcacaggatggtattgtgaccgtagcaattggtatcttgacggatttcaacctt
aagagtgaatctgaaactgagattctggctccaaaatgcattagtgctttgcttcttgta
ttgagcatgatgctgcaggcacagacaaaactctcgtctgaatatgtggaaggaaatcaa
ggtggatctttagtgccgagtgattctccgcaagactcaacagcagctttaaaggatgca
ttatcttcagatgttgctaaaggggagtcaaaccaggctttggaattgatttttggaaaa
tctacaggctatctgaccatggaagagggtcataaagctttactaatcgcctgtggcctc
ataaagcagcatgttccagctatgatcatgcaagctgtgcttcagttatgtgcccgtcta
acgaaatcacatgctttagctatccagtttctggaaaatggaggcttatcttcacttttt
aatcttccgaaaaaatgttgtttccctgggtatgatactgttgcatctgttatagtacgg
catcttgttgaagatcctcaaactctccaaattgctatggaaacagaaatacgacagacc
ttgagtgggaagagacatatcggtagggtgttacctcggacattcctgacaacaatggca
cctgtaatttctagagatccagttgtttttatgaaagctgtggcttcaacttgtcaattg
gagtcatcaggagggagggactttgtgatactgtcaaaggaaaaagaaaagccaaaagtt
tctggcagtgaacacggattctctttgaatgaaccccttggaatatctgaaaataagctt
catgatgtgtcaggaaaatgttcaaaaagccacagaagagtccctgctaacttcatccaa
gttattgatcagcttattgaccttgtcttgagttttcctagggtgaagaggcaggaagat
ggagaaaccaatttaatttcgatggaggtcgatgagccgactactaaagtgaagggtaaa
tcaaaagttggtgagccggagaaagcaagctcctcaagagttggtgagccggagaaagca
gaaatacctgaaaaatctgaagaactggccagggtaacatttattttgaagttgttgagt
gatattgttctcatgtactcacatggtaccagtgtcatactgagacgggatacagaaata
tctcaacttcgaggatccaatctacctgatgattcacctggaaatggagggttaatttac
catgtcattcatcgattgcttcctatatctctcgaaaagtttgttggacctgaagaatgg
aaggagaaactgtctgaaaaggcttcctggtttcttgttgttttgtgcagtcgttctaat
gaagggcgtaaaagaataatcaatgagctttcgagggttttatccgtatttgcttccttg
ggaaggagttctagtaaaagcgttctattacctgataaaagagttcttgcttttgctaac
ctggtttactcgatcttgacgaagaattcatcttcatcttcaagcaatttccctggttgt
ggctgttcacctgacgttgcaaagagcatgatggacgggggaactatccagtgtttgacc
agcatccttcacgtgattgatcttgaccaccctgatgctccaaagcttgtcactcttatt
ctcaagtctctcgagacactgacaagggctgcaaatgctgccgagcagctaaaatcagaa
gtaccaaacgagaaaaaaaacagagactctgatgagagacatgatagtcatggaaattca
actgagactgaagctgatgagctgaatcaaaataatagcagtctacagcaagtaacagat
gcagcaggtaatggacaggagcaggctcaagtttcctctcaaagcgcaggtgaaaggggt
tcgagtcaaacccaggctatgcctcaggatatgaggatagaaggcgatgagacaatactg
cctgaacctattcagatggatttcatgcgagaagagattgaaggtgatcaaatcgaaatg
agttttcatgttgaaaatagagctgacgatgatgtagatgatgacatgggcgatgaaggg
gaggatgatgaaggagatgatgaagatgcagatttagtggaagatggagctggtgttatg
tctcttgctggaactgatgtggaagaccctgaagatactggccttggagatgaatataat
gatgacatggttgatgaagatgatgatgatttccacgagaatcgtgtaatagaggtgcgg
tggagggaagctcttgatgggctggatcacttccagattcttgggcgatctggtggtgga
aatggttttattgatgatattacagctgagccgtttgaaggtgtgaatgttgacgatctg
tttgctctgcggagacccttgggctttgagcgtagacgccaaacaggcagatcttctctt
gatcgatctggctcagaggtacatggttttcagcacccgctcttctccaggccttcacaa
actggcaatacagcgtcagtttcagcaagtgctggcagtatatccaggcattcagaagct
ggcagctacgacgtagcacagttttacatgtttgatacaccggttctaccatttgatcaa
gtaccagttgatcctttcagcgctcgtttagcaggtggtggggcacctcctcctttgact
gattattctgttgtgggtatggattcatcaagaagaggggttggtgatagtcggtggact
gatataggtcatcctcagccaagtagcctatcagcttcaattgcccagttgatagaagaa
cattttatttccaacttgcgtgcttctgctccagtaaatactgttgttgaaagggagact
aataccacagaaatccaagagcagctgcacccggatgttcctccatctgttggaagtgaa
actgttttgggtgatggtaacgaaggtggtcaacaaagtgaagaacgtgaactactaaat
aacaatgaaaatgttaataatccacctgatgtaatggctgaaagtttcgctcaaggtcaa
gctaatctagcttctcctgtcagccaagatacaggtgaaagtctgcagcagcttgaagtt
atgcagcctcttcctttgaacagtacaccaaatgagattgatagaatggaagttggggaa
ggtgatggtgcgcctattgatcaagtagaccacgaagctgtgcatcttatctccactgct
cagggtcaacctgatacttccagtattcaaaatgtgtctgtaacagctatagctcctcca
gtagatgatcccgattctaattttcaaccaagtgttgatgttgatatgagtagtgatggt
gcagagggaaatcaaagtgtacaaccttcacctttggacggtgacaacaatgagctttcg
tccatggaagctacagaaaatgtgaggaatgatgaacaagttgaggaaggtagcttggat
ggtagggcacctgaagtgaatgccatcgatcctacatttttggaagcgctccctgaagat
ttgcgggcagaagtccttgcttctcagcaagctcagtccgtccagccaccaacttatgaa
ccacctccagtagacgacatagatcctgaatttttggctgcgcttcccccagatatccaa
acagaagttcttgctcaacaaagggcgcaaaggatggtacagcagtcacaaggacaggca
gttgatatggataatgcttcaattattgctactctacctgctgatttacgagaagaggtt
ctcttaacttcttcagaagcagttttggcagctttgccttcccctttacttgcggaagcc
cagatgctcagagaccgagcaatgagtcactatcaagctcgtagtagtgtttttggaagt
agtcacaggctgaataatcggaggaatggtttgggatacaataggctgacggggatggac
aggggtgttggagtcactattggtcagagggctgtttcatcttctgcagatggcttgaaa
gtaaaagagattgaaggagaccctcttgtgaatgctgatgccttgaaatcactaatcagg
ctattacgacttgcacagccattgggaaaaggccttctgcagaggcttctcttaaatcta
tgtgctcacagttttacaagggcaaacctggttcaacttttactggatatgattaggccg
gagatggaaacatcaccgagcgagttggcaataactaatccgcaaagactctatggctgt
caatcaaatgttgtttatggtcgatctcagctattgaatggtcttcctcctttagtgttc
cgccgggtgcttgaggttttgacgtacttggctacaaatcattctgctgttgctgacatg
ttgttttactttgattcgtcacttctatcccagttgtcaagccgaaaaggtaaagagaaa
gttactcatgtgacagattcccgagatctggagatacctctggttgtcttcctaaaactg
cttaatcggcctcagcttctgcagagtacatctcatctagggctggtcatgggcttgctg
caagtagttgtctacacagcagcgtcccgaattgagggttggtctccgtcatcaggagta
cctgagaaattagaaaacaaacctgtcggtgaagaagcttcaagtgaaacacgaaaagat
gctgaatctgagctagtgggtgaagctgacctatctgttgcaagaaggaagaattgtgct
gaaatatataacatattcttgcagttgccacagtctgacctctgcaatctttgcattctt
cttggatatgaagggttatcggacaaaatttactcgttagcgggagaggtactgaaaaag
ttggctgccgtagatgttgctcatcgcaaatttttcaccaaagaactctcagaattggca
agtagtttgagttcctcaactgtccgtgagctggcaacactaagcagtaaacagaagatg
agtcggagtacaggttccatggcaggtgcttcgattctccgtgttctgcaagtgcttagc
tcactaacttctcctattgatgagagcaatgtgggaaccgaaagagaaacagaacaggag
gaacaaaacattatgcagagactaaatgtggcattagagcccttgtggcatgaacttagt
cagtgtatcagcatgactgagttgcagctcgatcatactgcagctgcatcaaatataaac
cccggagatcatgttctagggatctctcctacgtcctctctctctccaggaactcagagg
ctcctccctcttattgaggctttctttgttctctgtgagaagattcaaactccgtcaatg
ttacagcaggatacaaatgtgacagctggagaagtaaaggagtcctctgctcatggttcc
tcatctaaaaccagcgtagattctcagaaaaaaactgatggttctgttacattttcaaag
tttgctgagaagcataggcgacttttgaattcatttattaggcaaaatccgagtttgctg
gagaagtccctttcaatgatgctgaaggcaccaaggctgattgattttgacaacaagaaa
gcgtacttcaggtcaagaataaggcaccaacatgatcaacatatttctgggccattgcgt
attagtgtccgccgagcttatgtgttggaagattcatacaaccagttacgtatgcgctcc
ccgcaggatctgaagggacgtctgaatgtgcagtttcaaggtgaggaaggtattgatgcc
ggtggtctaaccagagaatggtatcagttattgtcaagagttatatttgacaaaggagcg
ttactcttcactaccgttggaaatgatgccaccttccaaccgaatcccaattctgtttac
caaactgaacatctatcatacttcaaatttgttggtcgcatggtggcaaaggcgttgttt
gatgggcagcttttggatgtttatttcacccgttccttctataaacacatactcggtgtg
aaggtgacctatcatgacattgaggcggtggatcctgattactacaagaatttgaagtgg
ctattagagaatgacgtgagcgacatactcgacctcacatttagtatggacgcagatgag
gaaaaacacattctttacgaaaagacagaggtgacggactacgagcttaaacctggagga
cgaaacatacgggtaacagaagaaacaaaacatgaatatgttgaccttgtggccggccac
atacttaccaatgctattcggcctcaaatcaacgctttcctcgaaggctttaatgaatta
atacctcgtgagcttgtatcaattttcaatgataaagagcttgagctcctaatcagcggg
ttgcctgagattgattttgatgatctaaaagccaataccgagtataccagctacacggca
ggatcccctgttattcattggttctgggaggttgtcaaggctttcagcaaagaagatatg
gctagatttcttcaatttgtcactggaacatcaaaggttcctttggaaggcttcaaggca
ctgcaaggtatttctggccctcaaagattacaaatccacaaagcatatggagccccagag
cggctgccatcagctcatacatgttttaaccaactagacctccctgagtatcaatctaag
gaacagcttcaggaacgcctgctacttgcaattcacgaagccagtgaaggttttgggttt
gcttga

DBGET integrated database retrieval system