KEGG   Arabidopsis thaliana (thale cress): AT1G59820
Entry
AT1G59820         CDS       T00041                                 

Gene name
ALA3
Definition
(RefSeq) aminophospholipid ATPase 3
  KO
K14802  phospholipid-transporting ATPase [EC:7.6.2.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT1G59820 (ALA3)
Enzymes [BR:ath01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     AT1G59820 (ALA3)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    AT1G59820 (ALA3)
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase E1-E2_ATPase Hydrolase Hydrolase_3 DUF1103 IlvC
Other DBs
NCBI-GeneID: 842275
NCBI-ProteinID: NP_176191
TAIR: AT1G59820
UniProt: Q9XIE6 A0A178WFR7
Position
1
AA seq 1213 aa
MVRSGSFSVDSSATHQRTPSRTVTLGHIQPQAPTYRTVYCNDRESNQPVRFKGNSISTTK
YNVFTFLPKGLFEQFRRIANIYFLGISCLSMTPISPVSPITNVAPLSMVLLVSLIKEAFE
DWKRFQNDMSINNSTVEILQDQQWVSIPWRKLQVGDIVKIKKDGFFPADILFMSSTNSDG
ICYVETANLDGETNLKIRKALERTWDYLVPEKAYEFKGEIQCEQPNNSLYTFTGNLVVQK
QTLPLSPDQLLLRGCSLRNTEYIVGAVVFTGHETKVMMNAMNAPSKRSTLEKKLDKLIIT
IFCVLVTMCLIGAIGCSIVTDREDKYLGLHNSDWEYRNGLMIGFFTFFTLVTLFSSIIPI
SLYVSIEMIKFIQSTQFINRDLNMYHAETNTPASARTSNLNEELGQVEYIFSDKTGTLTR
NLMEFFKCSIGGVSYGCGVTEIEKGIAQRHGLKVQEEQRSTGAIREKGFNFDDPRLMRGA
WRNEPNPDLCKELFRCLAICHTVLPEGDESPEKIVYQAASPDEAALVTAAKNFGFFFYRR
TPTMVYVRESHVEKMGKIQDVAYEILNVLEFNSTRKRQSVVCRFPDGRLVLYCKGADNVI
FERLANGMDDVRKVTREHLEHFGSSGLRTLCLAYKDLNPETYDSWNEKFIQAKSALRDRE
KKLDEVAELIEKDLILIGSTAIEDKLQEGVPTCIETLSRAGIKIWVLTGDKMETAINIAY
ACNLINNEMKQFVISSETDAIREAEERGDQVEIARVIKEEVKRELKKSLEEAQHSLHTVA
GPKLSLVIDGKCLMYALDPSLRVMLLSLSLNCTSVVCCRVSPLQKAQVTSLVRKGAQKIT
LSIGDGANDVSMIQAAHVGIGISGMEGMQAVMASDFAIAQFRFLTDLLLVHGRWSYLRIC
KVVMYFFYKNLTFTLTQFWFTFRTGFSGQRFYDDWFQSLFNVVFTALPVIVLGLFEKDVS
ASLSKRYPELYREGIRNSFFKWRVVAVWATSAVYQSLVCYLFVTTSSFGAVNSSGKVFGL
WDVSTMVFTCLVIAVNVRILLMSNSITRWHYITVGGSILAWLVFAFVYCGIMTPHDRNEN
VYFVIYVLMSTFYFYFTLLLVPIVSLLGDFIFQGVERWFFPYDYQIVQEIHRHESDASKA
DQLEVENELTPQEARSYAISQLPRELSKHTGFAFDSPGYESFFASQLGIYAPQKAWDVAR
RASMRSRPKVPKK
NT seq 3642 nt   +upstreamnt  +downstreamnt
atggttcgatcgggtagttttagcgtcgattcttcggcgactcatcaacggactccgtct
cgaacggttacgttgggtcatattcaaccacaggctccgacttatcgtaccgtttattgt
aatgatcgggaatctaatcaacccgtccggttcaagggtaattcgatttctacaacaaag
tataatgttttcacatttctgcccaagggtctgtttgaacagtttaggcgcatagcgaac
atatactttcttggaatttcgtgtctatcaatgacaccaataagtcctgtgagtccaata
acaaatgtagctccactgtcaatggtgcttcttgtttctctgattaaagaggctttcgaa
gactggaaacggtttcaaaatgatatgtccataaataatagcacagtggaaatcttacaa
gatcaacagtgggtatctattccgtggagaaagttgcaagttggagatattgtcaagata
aaaaaagatggatttttcccagcagatattcttttcatgtccagtactaattctgatggt
atctgctacgttgagactgcaaacctagatggagaaacaaatttgaaaataagaaaggca
cttgaaaggacatgggattacttggtaccagagaaagcttatgagtttaaaggtgaaatt
cagtgtgagcaaccaaacaattctctgtacacttttactgggaaccttgtagtccaaaag
cagacgttacctctctctccggaccagcttttattgcgtggatgcagtcttaggaacaca
gaatacatagttggagctgtagtttttactggtcatgagacgaaggtgatgatgaatgcc
atgaatgctccttccaaaagaagtacgctggaaaagaagcttgacaaactcattattaca
atattttgtgtccttgtcacgatgtgtctgattggagctataggctgttcaattgtgacg
gatcgtgaggacaaatacttgggtcttcataactcagattgggaataccgcaatggactc
atgataggatttttcacctttttcacgctagtcactctgttctcatcaattataccaatc
tccctttatgtttctattgagatgatcaagtttatccagtcgacccagtttatcaaccgc
gatcttaatatgtatcatgctgaaacaaatacccctgcctcggccaggacttctaatttg
aacgaggagcttggacaggtggaatacatattttccgataaaaccggaacactgacaaga
aatttgatggagttcttcaaatgttcaattggaggtgtaagttatggatgtggtgtcact
gaaatagaaaaaggaatcgctcagcgtcatggcttaaaagttcaagaggagcaaaggtcc
acgggtgcaataagagaaaaaggatttaattttgatgatccaaggctaatgcggggagct
tggagaaacgaacctaatcctgatctttgcaaggaactgtttagatgcctggccatctgt
cacactgtccttcctgaaggtgatgagtcccctgagaagattgtttatcaagctgcatct
ccagatgaagctgccttagttactgctgccaagaattttggattcttcttttataggcgt
actccaactatggtgtatgttcgcgagtctcatgtggagaagatgggaaagattcaagac
gtggcctatgagatcctaaacgttctcgagttcaacagtactaggaagcgccagtctgtt
gtatgtcgtttcccagatggaaggcttgtactctactgtaagggcgctgataatgttatc
tttgagagattggctaatggtatggacgatgttaggaaagtaacaagagaacatttggaa
cattttgggtcttctggattgcgtaccctttgcctagcctataaagatttaaatcctgaa
acctatgatagttggaatgaaaagttcatccaagccaaatctgcattacgagaccgtgag
aagaagttagatgaggtggcagaactcatcgagaaggatcttatcctcatcggatcaact
gcgatagaagacaaacttcaggaaggggtgcctacctgcatagaaacattatcaagagct
ggaattaagatctgggtgttaacaggggacaaaatggaaacggctattaatattgcatat
gcatgcaacttgatcaacaatgaaatgaaacaatttgtcattagttctgaaaccgatgca
atcagagaagctgaagaaaggggtgatcaagttgagattgctcgtgttatcaaagaagaa
gtaaagagggagctgaaaaagagtcttgaggaagctcaacactctttgcataccgtagct
ggaccaaaattgtctctcgttattgatggcaagtgtttaatgtatgcattagacccgagt
ttacgcgtgatgctgctcagcttgagcttgaactgtacttcagttgtatgctgtcgtgta
tctccgttacagaaagcacaggtgacaagcttggtgagaaaaggggcacaaaagattact
cttagtattggtgatggggccaatgatgttagcatgattcaagctgctcatgttggtata
ggaataagtgggatggagggaatgcaagctgtgatggctagtgattttgccattgctcag
ttcagatttcttacagatttacttcttgtccatggacggtggtcatatcttagaatctgc
aaggttgtcatgtatttcttctacaagaatcttaccttcactttgactcagttttggttc
acatttcgaactggattttctgggcaaaggttttatgatgattggttccagtcattgttt
aatgttgtatttacagctcttcctgtcatcgtccttgggctgtttgagaaggatgtgagt
gcatccctttcgaaaagatatccagaactgtatagagagggaatacgtaactcatttttc
aaatggagagttgtagcagtatgggctacttctgctgtgtatcagtctcttgtctgctat
ctctttgtgacaacctcatctttcggtgctgtaaattcatcaggcaaagtatttggcctc
tgggatgttagcacaatggtcttcacatgtctggtgattgctgtgaatgtgcgcattctt
ttgatgagcaattccattaccagatggcattatatcacagtcggtgggagtattcttgca
tggctcgtttttgctttcgtatactgcgggattatgacaccacatgataggaatgaaaat
gtctactttgtcatatatgttctgatgagtacattctatttctacttcacattgttgctt
gttcccattgtctctcttctaggcgatttcatcttccaaggggtggagagatggttcttc
ccgtatgattatcagatcgttcaagaaatacataggcacgagtcagatgcaagcaaggca
gatcagctggaggtagagaatgagctcacacctcaagaggcgagaagctatgcgatatca
caattgcctcgggagctctcaaagcacactgggtttgcgtttgattcaccaggttatgaa
tctttctttgcgtctcagttagggatatacgcgccacagaaggcgtgggatgtggcaagg
agagccagtatgagatcacggccaaaggtaccgaagaagtaa

DBGET integrated database retrieval system