KEGG   Arabidopsis thaliana (thale cress): AT1G61820Help
Entry
AT1G61820         CDS       T00041                                 

Gene name
BGLU46
Definition
(RefSeq) beta glucosidase 46
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT1G61820 (BGLU46)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT1G61820 (BGLU46)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT1G61820 (BGLU46)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT1G61820 (BGLU46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 842479
NCBI-ProteinID: NP_850968
MIPS: AT1G61820.1
TAIR: AT1G61820
Araport: AT1G61820
UniProt: O80690
Position
1
AA seq 516 aa AA seqDB search
MKTFANFAILFLLQSLLFPLYSSCLHQTSDDSSPFPSDFLFGTASSAFQYEGAFLTDGKG
LNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQSMNFLGVNSYRLSISWSRVLPNGR
FGVINYKGIKYYNNLIDALIKKGITPFVTLNHFDYPQELENRFKSWLSSEMQKDFGYLAD
ICFKHFGDRVKHWITINEPNQHISLAYRSGLFPPARCSMPYGNCTHGNSETEPFIAAHNM
ILAHAKAIQIYRTKYQREQKGIIGIVVQTSWFEPISDSIADKNAAERAQSFYSNWILDPV
VYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKSDFLGINHYTSYFIQDCLITACNSGDGA
SKSEGLALKLDRKGNVSIGELTDVNWQHIDPNGFRKMLNYLKNRYHNIPMYITENGFGQL
QKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFG
LFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQIDK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttttgccaactttgcaattctgtttttattacaaagcttattgtttcctctt
tacagttcatgccttcatcaaacttcagatgattcatctccatttccttctgatttcctc
tttggcacagcttcttctgctttccagtatgaaggtgccttcttaaccgatggaaaaggt
ctgaacaattgggatgtctttgcccatgaaaaccctgggaaaatagttgatggaagcaat
ggagacatagctacggaccaatatcatcgatatatggaagatatccaatcaatgaatttt
cttggagtcaatagttacagattatctatttcctggtctagagtcttacctaatggaaga
tttggagttattaattataagggaataaagtattacaacaatttgatcgacgctcttatt
aaaaaagggattacaccatttgtgacgttgaaccacttcgactatcctcaagaactcgag
aaccggttcaagagttggttaagctccgagatgcagaaagatttcgggtacttagctgat
atatgtttcaaacattttggagaccgagttaaacactggatcacgattaacgaaccaaac
caacatataagcttagcatatcgaagtggtttgtttccaccagcgcggtgctccatgcca
tacggaaattgtactcacgggaactcagaaactgagccttttatagccgctcataatatg
atcctcgcacatgcaaaggcgattcaaatataccgaaccaaatatcaaagagaacaaaag
ggaatcattggcattgtggtacaaacatcatggtttgaacccataagcgattcgattgct
gataaaaatgctgccgagagagctcaatcattttattcaaattggattctagatcccgtt
gtgtatgggaaatatccggaagaaatggtgaatctacttggatcagctttgccaaaattt
tcgagcaatgaaatgaacagcctaatgagctataaatcagactttttgggtattaatcac
tatacaagttacttcatacaagattgtttgatcactgcttgtaattctggagacggagct
tctaaaagcgaaggattagccctcaaattggaccggaaaggaaatgtttccatcggagaa
ctgaccgacgtaaattggcagcatattgatcctaacggattcagaaagatgttgaattac
ctaaaaaataggtaccacaacataccaatgtacatcaccgaaaatggtttcggacagttg
caaaaaccagagacaacagttgaagaacttctgcatgatacaaaaaggatacaatacttg
agtggatatttggatgctttgaaagcagcaatgagggatggagcaaatgtgaagggatat
ttcgcatggtcactattagataattttgaatggttgtacggatacaaggttcgatttggg
ctattccacgttgattttacaactttgaaaaggacaccaaagcaatcagctacatggtac
aagaacttcattgaacagaacgtgaatatagaagatcaaatagataaataa

DBGET integrated database retrieval system