KEGG   Arabidopsis thaliana (thale cress): AT1G62020Help
Entry
AT1G62020         CDS       T00041                                 

Definition
(RefSeq) Coatomer, alpha subunit
  KO
K05236  coatomer subunit alpha
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G62020
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G62020
Membrane trafficking [BR:ath04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    AT1G62020
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G62020
  Exosomal proteins of bladder cancer cells
   AT1G62020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40 Fis1_TPR_C ENTH
Motif
Other DBs
NCBI-GeneID: 842497
NCBI-ProteinID: NP_176393
MIPS: AT1G62020.1
TAIR: AT1G62020
Araport: AT1G62020
UniProt: Q94A40 A0A178WAY4
Position
1
AA seq 1216 aa AA seqDB search
MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH
NSQPLFVSGGDDYKIKVWNYKNHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
NWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR
LTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE
VDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP
EMNLLAAGHDSGMIVFKLERERPAFALSGDSLFYAKDRFLRYYEYSTQRDSQVIPIRRPG
TPSLNQSPRTLSYSPTENAVLICSDLDGGSYELYIIPKDSVGRSDVVQDAKRGTGGSAVF
IARNRFAVLEKSTSQVLVKNLKNEVVKKSPLPIPTDAIFYAGTGNLLCRSEDKVVIFDLQ
QRLVLGELQTPFVRYVVWSSDMESVALLSKHTIIIASKKLVLQCTLHETIRVKSGAWDDN
GVFIYTTLNHIKYCLPNGDSGIIRTLDVPIYITKVSGNTIFCLDRDGKNKAITINATEYI
FKLSLLRKRYDHVMSMIKNSQLCGQAMIAYLQQKGFPEVALHFVEDERIRFNLALESGNI
SVAVASATQINEKDHWYRLGVEALRQGNSGIVEFAYQQTKNFERLSFLYLITGNLDKLSK
LMKIAEVKNNVMGQFHNALYLGDVKERVKILENAGHLPLAYITASVHGLNDIAERLATEL
GDNVPSLPEGKTPSLLMPPTPIMCGGDWPLLRVMKGIFEGGLESADRGGTVDEEDVEGDW
GEELDINVDGMENRDIEDILAAAEAGEEENDEEGGWGLEDLVLPPELDTPKASANARSSV
FVTPPQGMPVSQSWSQKSSLAAEQAAAGSFDTAMRLLHRQLGIKNFTPLKSMFLDLFNGS
HSYLRAFSSCPVVPLAIERGWSESSSPNVRSPPALVYDFSQLDEKLKSGYKATTTGKFTE
ALRLFLSILHTIPLVVVETRREVDEVKELIVIVKEYVLGLQMELKRREMKDDPVRQQELA
AYFTHCNLQTPHLRLALLSAMGVCYKAKNLATASNFARRLLETSPVDSQAKMARQVVQAA
ERNMTDETKLNYDFRNPFVVCGSTYVPIYRGQKDVSCPYCTARFVPNQEGNICTVCDLAV
IGADASGLLCSPSQVR
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgttgacaaagttcgaaaccaaaagtaacagagttaagggactgagttttcaccctaaa
cgaccatggattctcgcgagtttgcacagtggcgtgatccagctctgggattatcgtatg
ggtactttgatcgatagattcgacgaacacgaaggacctgttcgtggtgttcatttccac
aattctcagcctctcttcgtctccggaggggatgattacaagattaaagtgtggaactac
aaaaaccacaggtgccttttcactcttctagggcatcttgattatatccgcacggttcag
ttccatcatgagtacccatggattgtgagtgcaagtgatgatcaaactatccgtatatgg
aactggcaatcacggacttgtgtttctgtattgactggtcacaatcattatgttatgtgt
gcttctttccatccgaaagaagacctcgtcgtatcagcttcgttagatcagactgttcgt
gtttgggatattggtgctcttaggaagaagactgtatctcctgctgatgatatcatgagg
ttgactcagatgaatagtgatctttttggtggagttgatgccattgtcaagtacgttctt
gaaggtcatgatagaggtgtaaactgggctgcttttcatcccaccctgcctcttattgtc
tcgggtgcagatgaccgccaagtaaagctgtggcgtatgaatgaaactaaagcttgggag
gtggatacattgcgaggccatatgaataacgtttcatctgttatgttccatgcaaaacag
gacataattgtatcaaactctgaagataagagcatccgtgtctgggatgctaccaagcga
actggacttcagactttccgtcgtgaacatgatagattctggattcttgcagttcaccct
gagatgaatctactagcagcaggacatgacagtggcatgattgtgttcaagcttgagaga
gaacgtcctgcatttgctttgagtggggattctttgttctatgccaaggatagattcttg
cggtactatgaatattcaactcaaagggattcccaagttatccctatacggcgtccgggt
actccaagcttgaatcaaagtcctaggactctatcatacagtcccactgaaaatgcagtt
ttgatctgctcagatctggatggtggttcgtatgagttgtacatcataccgaaagatagt
gttggcaggagtgacgttgtgcaagatgcaaagagagggacaggtggctctgcagtattc
attgcccgtaaccgatttgctgttctcgagaaaagcaccagccaagtgctagtcaagaat
ctaaagaatgaggtggttaaaaagagtcctctgcctattcccacagatgctatcttttat
gctgggactgggaatttgctttgtagatctgaggataaagtagttatctttgacctccag
caaaggcttgttcttggtgagcttcagacaccatttgttaggtacgttgtttggtccagt
gatatggagagtgttgctttgctcagcaaacatactatcattatcgcgagcaaaaaactt
gttctccagtgcacgcttcatgagacgatacgtgtgaaaagtggagcttgggacgataat
ggtgtcttcatttacacaactttgaatcatatcaagtactgtcttcctaatggagatagt
ggaatcatccgaaccctggatgtcccaatctatatcaccaaggtgtctggtaatacaatc
ttttgcttggatcgggatggcaaaaacaaggctatcaccattaatgcaaccgagtacatt
ttcaagctttcactgctgaggaagagatatgatcatgtcatgagcatgataaagaactct
cagctatgtggacaggctatgattgcttacctgcagcagaaaggattccctgaagttgcc
ctccattttgttgaagatgagaggatccgattcaatctggctcttgaaagtggcaacatc
agtgtggctgttgcatccgctacacagattaacgagaaagaccactggtatagacttgga
gtggaggctcttcgccaaggtaattctggaattgttgagtttgcataccagcagacaaag
aactttgagaggttatcttttctttatctcattactggaaatttggacaagctttcaaag
ttgatgaagattgcagaagtgaagaacaacgtaatgggacagtttcacaatgctctctac
ctaggagatgttaaagagcgtgttaagatactggagaatgctggtcatttgcctctagct
tatatcacagcttcggttcatggtttaaatgacattgctgagcgactggcaactgagtta
ggagacaacgtgccctcattgcctgaaggaaaaactccatcgcttctaatgccaccgaca
cccatcatgtgtggtggtgattggcctcttcttagagtgatgaaaggaatatttgaagga
ggacttgagagtgcagacagaggaggtactgttgatgaagaagatgttgaaggggattgg
ggtgaggaacttgacattaatgttgatggaatggagaacagagatattgaagacattttg
gcggctgcagaagcaggtgaagaagaaaacgatgaggaaggtggatggggacttgaagac
ttggtgctcccaccagagcttgacactcctaaagcctctgctaatgcacgttcatctgtt
tttgtgacacctccccaaggtatgcccgtaagtcagagctggagccagaaatcttctctt
gctgctgagcaagccgcagcgggaagcttcgacactgcaatgcgtctgctccacagacag
cttggtatcaagaactttacacctttgaaatcgatgtttctagatctgttcaatggcagc
catagctatctgcgtgctttttcttcatgtcctgtggttccacttgccattgagcgtgga
tggagcgagtcttccagtcccaacgtccgtagcccaccagctcttgtttatgatttctct
cagctagacgagaagctcaaatccggctacaaagctacaacaactgggaaattcactgag
gctctccgtctcttcctttctatcctgcacaccatccctctagtggtagtcgagacaaga
agagaagtggatgaggtcaaggaattaatcgttatcgttaaagaatatgtccttggtctt
caaatggagctcaagaggagagagatgaaagatgatccggtgaggcagcaagagctcgct
gcttacttcactcactgcaacctccaaacacctcacttacggcttgcgctgcttagtgca
atgggtgtctgctacaaggcaaagaacctcgccactgcttctaatttcgccagaagactg
ttggaaacaagcccagttgatagccaagccaagatggctagacaagttgtgcaagccgct
gaacgtaacatgaccgatgaaacaaagcttaactacgacttcaggaacccttttgtggta
tgtggttccacatatgtcccgatctacagaggacagaaagacgtctcatgtccttactgc
accgcccggtttgtaccaaaccaggaaggaaacatctgcacggtctgtgatctagcagtg
attggcgcagacgcatctggtttgttatgctctccatctcaagtccggtga

DBGET integrated database retrieval system