KEGG   Arabidopsis thaliana (thale cress): AT1G62310
Entry
AT1G62310         CDS       T00041                                 

Definition
(RefSeq) transcription factor jumonji (jmjC) domain-containing protein
  KO
K15601  [histone H3]-dimethyl-L-lysine9 demethylase [EC:1.14.11.65]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G62310
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.65  [histone H3]-dimethyl-L-lysine9 demethylase
     AT1G62310
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    AT1G62310
SSDB
Motif
Pfam: JmjC zf-4CXXC_R1 Cupin_8 zf-RING_2 Cupin_2
Other DBs
NCBI-GeneID: 842529
NCBI-ProteinID: NP_176421
MIPS: AT1G62310.1
TAIR: AT1G62310
UniProt: C0SV12
Position
1
AA seq 883 aa
MDSGVKLEHMNCFQLSYQYSWTTRKKRTLKPFMSKGSSPSSSSDSRKRKLSRAEDSDDSA
VKRNAKRRRKICKVEEYYEDDDCILSDWVQRNTAKRIDKRNEEVEVMVKIESGDDCTIGK
WFSDVSSKRKDKRQVEVDEDEEWEEEVTLCSKIKATSSRSRTHSLSANSPENVTDVISPC
RSRSPASNVSDSIQKNDCTSSRKQSGPICHQCLKGERITLLICSECEKTMFCLQCIRKWY
PNLSEDDVVEKCPLCRQNCNCSKCLHLNGLIETSKRELAKSERRHHLQYLITLMLPFLNK
LSIFQKLEIEFEATVQGKLPSEVEITAAISYTDERVYCDHCATSIVDLHRSCPKCSYELC
LKCCQEIREGSLSERPEMKFHYVDRGHRYMHGLDAAEPSLSSTFEDEEANPSDAKWSLGE
NGSITCAPEKLGGCGERMLELRRILPLTWMSDLEHKAETFLSSYNISPRMLNCRCSSLET
ELTRKSASRTTSSDNYLFCPESLGVLKEEELLHFQEHWAKGEPVIVRNALDNTPGLSWEP
MVMWRALCENVNSTSSSEMSQVKAIDCLANCEVEINTRQFFEGYSKGRTYENFWPEMLKL
KDWPPSDKFEDLLPRHCDEFISALPFQEYSDPRTGILNIATKLPEGFIKPDLGPKTYIAY
GIPDELGRGDSVTKLHCDMSDAVNILTHTAEVTLSQEQISSVKALKQKHKLQNKVDKQST
EDCNEKEEEEEEELNMPEISSNENEETGSALWDIFRREDVPKLEEYLRKHCKEFRHTYCS
PVTKVYHPIHDQSCYLTLEHKRKLKAEYGIEPWTFVQKLGEAVFIPAGCPHQVRNLKSCT
KVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEASLLSL
NT seq 2652 nt   +upstreamnt  +downstreamnt
atggattctggagttaaattggagcatatgaattgtttccaattatcttatcaatattcg
tggacgactaggaagaagagaactctgaaaccattcatgtcaaaaggttctagccctagt
agtagtagtgatagtaggaaacggaagctttcgagagctgaagatagcgatgattcagcg
gttaaacggaatgcgaaacgaaggagaaagatatgcaaagtagaagaatattatgaagat
gatgattgcatattaagtgattgggttcagaggaatactgcgaaaaggattgataagcgc
aacgaagaagttgaagttatggttaagatagagtcaggtgatgattgcacaataggtaag
tggttttctgatgttagtagtaaaaggaaagataaacgacaagtagaagttgatgaagat
gaggaatgggaagaagaagttacactgtgttctaagatcaaggcaacgtcgtcgcgaagc
agaacccatagtttaagtgctaacagtccagaaaatgttacagatgttattagtccttgt
cgttcacggtctccagcttctaatgtatcagattccattcagaaaaatgactgcaccagt
agtagaaaacagagtggcccaatttgtcatcagtgcttgaaaggggaaaggataacactt
ctcatttgtagtgaatgtgagaagacaatgttttgtcttcaatgtataaggaaatggtat
ccaaatctatctgaggatgatgttgttgagaaatgtcctttatgccgtcaaaattgtaat
tgtagcaaatgcttgcatttgaatggtttaattgagacatcgaagagggaactcgcgaaa
tctgaaagacgtcatcatctccagtatttgattacgttgatgcttccttttctgaataag
ttatccatattccagaagctagagattgaatttgaggcaactgttcaaggaaaactgcct
tctgaagttgaaataactgcggctataagctacactgatgaacgtgtatactgtgatcat
tgtgcaacttcaattgttgacttgcatcgaagctgtccaaagtgctcttatgaactttgt
ttgaagtgctgtcaagagattcgtgaaggatcgctttctgaacgccctgaaatgaagttc
cattatgttgatagaggacatcgatatatgcatggtttagatgctgcggaaccgagcttg
tcttccacttttgaagacgaagaagctaacccatctgacgctaagtggagccttggtgaa
aatggaagcatcacttgtgcaccagaaaagctaggtggttgtggtgaacggatgctagag
cttaggcggatcctaccactcacgtggatgtcagatttagagcacaaagcagagactttc
ttatcatcatacaatataagccctagaatgttgaactgtaggtgttcttctttggagaca
gagctgacaaggaaatcagcttcgaggacaacatcaagtgacaactaccttttctgtcct
gaatctctcggtgtcttgaaggaagaagagcttcttcattttcaagagcattgggcaaaa
ggcgaaccagtaatcgttaggaacgctcttgacaacacacctggtttaagctgggagccg
atggttatgtggcgggctttatgcgaaaatgtgaattcaacatcaagctctgagatgtcc
caagtcaaagcaattgattgcttagctaattgtgaggtggagatcaatactcgtcagttc
tttgaaggttatagcaaaggaagaacatatgaaaatttctggcctgagatgttgaagctt
aaggactggcctccttctgataagtttgaagatcttctacctcgtcactgtgatgagttc
atatccgcgttacctttccaggaatatagtgatcctagaactggaattcttaacattgca
acaaagcttcctgaaggatttatcaaaccagatttaggtccaaaaacttacatcgcctat
gggattccagatgagcttggtagaggcgattccgtgactaagcttcactgcgatatgtca
gacgcggtgaatattctaacgcatacggccgaagtgaccctaagtcaagaacaaatatcc
tcagtcaaagcactgaaacagaaacacaagttacagaataaggtcgataaacagagtact
gaagactgtaacgaaaaggaagaagaagaagaagaagaattgaacatgccagagatttcg
agcaatgaaaatgaagaaacgggcagtgctctttgggacatatttaggagagaagacgtt
cccaagttagaagagtatctaagaaagcattgcaaagaatttagacacacttattgtagt
ccagttacaaaggtttatcatccgatacatgaccaatcatgctatttaaccttagagcac
aaaagaaaactcaaggcggaatatgggatcgagccatggacatttgtgcaaaagctaggt
gaagcggtgtttattcccgcgggttgtcctcatcaagttcggaatctaaagtcgtgcaca
aaagtcgcagttgactttgtgtcaccagagaacatccatgagtgtctgcgtttgaccgaa
gagtttcgccaacttcccaaaaaccacaaggccagagaggacaaactcgaggcaagtctt
ttatctctttga

DBGET integrated database retrieval system