KEGG   Arabidopsis thaliana (thale cress): AT1G62740Help
Entry
AT1G62740         CDS       T00041                                 

Gene name
Hop2
Definition
(RefSeq) stress-inducible protein
  KO
K09553  stress-induced-phosphoprotein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chaperones and folding catalysts [BR:ath03110]
 Other chaperones and cochaperones
  Sti1 / p60
   AT1G62740 (Hop2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_12 TPR_16 TPR_14 TPR_19 TPR_17 TPR_10 TPR_7 TPR_9 ANAPC3 Fis1_TPR_C TPR_3 SPESP1 Sec8_exocyst Rapsyn_N DUF2225
Motif
Other DBs
NCBI-GeneID: 842572
NCBI-ProteinID: NP_176461
MIPS: AT1G62740.1
TAIR: AT1G62740
Araport: AT1G62740
UniProt: Q5XEP2
Position
1
AA seq 571 aa AA seqDB search
MADEAKAKGNAAFSSGDFNSAVNHFTDAINLTPTNHVLFSNRSAAHASLNHYDEALSDAK
KTVELKPDWGKGYSRLGAAHLGLNQFDEAVEAYSKGLEIDPSNEGLKSGLADAKASASRS
RASAPNPFGDAFQGPEMWSKLTADPSTRGLLKQPDFVNMMKEIQRNPSNLNLYLQDQRVM
QALGVLLNIQIRTQQAGDDMEIGEEEMAVPSRKEPEVEKKRKPEPEPEPEPEFGEEKQKK
LKAQKEKELGNAAYKKKDFETAIQHYSTAMEIDDEDISYITNRAAVHLEMGKYDECIKDC
DKAVERGRELRSDYKMVAKALTRKGTALGKMAKVSKDYEPVIQTYQKALTEHRNPETLKR
LNEAERAKKELEQQEYYDPNIGDEEREKGNDFFKEQKYPDAVRHYTEAIKRNPKDPRAYS
NRAACYTKLGAMPEGLKDAEKCIELDPTFLKGYSRKGAVQFFMKEYDNAMETYQKGLEHD
PNNQELLDGVKRCVQQINKANRGDLTPEELKERQAKGMQDPEIQNILTDPVMRQVLSDLQ
ENPAAAQKHMQNPMIMNKIQKLISSGIVQMK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagcaaaagctaaaggaaacgcagctttctcctccggtgacttcaattcc
gccgttaatcacttcaccgacgcaatcaacctaacaccaaccaatcacgttctcttctca
aaccgttccgctgctcacgcatcgcttaatcactacgacgaagctctctcagacgcgaag
aagactgttgaacttaaaccagattggggaaaaggttatagccgtctcggtgctgctcac
ttaggtctaaatcagttcgatgaagccgtggaggcgtattcgaaagggcttgagattgat
ccaagtaacgaaggtttgaaatcaggtttagctgatgcgaaagcttctgcgtctaggtca
cgcgcttccgcgcccaatccgtttggtgatgcttttcagggaccggagatgtggtcgaaa
ttgacggcggatccttctactagagggttattgaaacagcctgattttgttaatatgatg
aaggagattcagaggaaccctagtaatcttaatctttatttgcaagatcagagagttatg
caagctcttggagttttgttgaatattcaaatcaggactcaacaggctggtgatgatatg
gagattggtgaggaagagatggctgtgccttctaggaaggagcctgaggtagagaagaaa
cgaaaacctgagcctgagcctgagcctgagccggagtttggagaagagaagcagaagaag
cttaaagctcagaaggagaaagagttggggaatgctgcgtataagaagaaggacttcgaa
actgcaatccagcattactctacagctatggagattgatgatgaagatatctcttatatc
actaatcgtgctgctgttcatctagagatgggaaagtatgatgagtgtatcaaggattgt
gataaggctgttgaaaggggtagagagcttaggtctgattacaagatggtggctaaagct
ttgactaggaaaggaactgctttagggaagatggctaaagtctcgaaagactatgaacct
gtgattcagacttaccagaaagctcttacggagcatcgtaaccctgaaacattgaagaga
ctgaatgaggcagagagagcaaagaaagagttggagcagcaagagtactatgatcctaat
atcggtgatgaggagcgtgagaaaggtaatgacttttttaaggagcaaaagtatcctgat
gctgtgagacattacactgaagcgatcaagaggaatccaaaagacccgagagcatatagc
aaccgggctgcatgttacactaaactgggggcaatgcccgaaggattaaaagatgcagag
aaatgtatcgagctcgatccaacattcttaaagggatacagtagaaaaggtgcagtccag
ttcttcatgaaggagtatgacaatgcaatggaaacgtaccagaagggtctcgaacatgat
cctaataaccaggaacttcttgatggtgttaaaagatgtgtacaacagataaacaaggca
aaccgtggcgaccttactcctgaggaattgaaagaaagacaggctaagggaatgcaagac
ccagaaattcagaacattctcacagatcctgtaatgagacaggtactgtctgatctccag
gagaatccagcagcagcacaaaagcacatgcagaacccaatgatcatgaacaaaatccaa
aagcttatcagctcaggaatcgtccagatgaaataa

DBGET integrated database retrieval system