KEGG   Arabidopsis thaliana (thale cress): AT1G63270
Entry
AT1G63270         CDS       T00041                                 

Gene name
ABCI1
Definition
(RefSeq) non-intrinsic ABC protein 10
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_16 AAA_23 AAA_15 T2SSE AAA_22 RsgA_GTPase AAA_18 AAA_5 AAA AAA_14 VirE FtsK_SpoIIIE G-alpha TsaE AAA_28 MeaB NACHT AAA_30 SRP54 MutS_V AAA_13
Other DBs
NCBI-GeneID: 842633
NCBI-ProteinID: NP_176516
MIPS: AT1G63270.1
TAIR: AT1G63270
UniProt: Q9C8T1 A0A178W7Z5
Position
1
AA seq 229 aa
MSIRRPQIPRLLLQNVSCMRNAQQILRHVNVSLHDGGALVLTGTNGSGKSTFLRMLAGFS
KPSAGEILWNGHDITQSGIFQQYKLQLNWISLKDAIKERFTVLDNVQWFELLENKIGKAQ
PALELMGLGRLVKEKSRMLSMGQRKRLQLARLLAIDRPIWLLDEPSVALDDEGVRLLEYI
IAEHRKKGGIVIVATHLPIDIEDAMILRLPPRFPRKMTLIDMLDRADIS
NT seq 690 nt   +upstreamnt  +downstreamnt
atgtctatcaggaggcctcaaatccctcggcttcttcttcaaaacgtctcttgcatgaga
aacgcgcagcagattctaagacacgtgaatgtatctcttcatgacggtggtgcacttgtc
ttaactggaacaaacggatccggtaaatcaactttcttgagaatgttagctggattctca
aaaccctctgcaggagaaatcctttggaatggtcacgacatcacacagtcaggaatcttt
caacaatacaaactccaactcaactggatctctttaaaagacgccatcaaagagagattc
acagtactcgataatgtccaatggtttgagcttctcgagaataaaatcggcaaagctcaa
cccgcgttggagctaatggggttagggagactggtgaaagagaaatcgagaatgttatcg
atgggtcagaggaaaagattgcaacttgcgaggctcctcgctatcgatagaccgatatgg
cttttggatgaaccatccgttgctttggatgatgaaggtgttagattgctcgagtatatt
atcgcagagcataggaaaaaaggagggattgtgattgtcgcgactcatcttccgatagac
attgaagatgctatgatcttgaggcttcctcctaggtttccaaggaaaatgactttgatt
gatatgcttgatcgtgcagacatttcttag

DBGET integrated database retrieval system