KEGG   Arabidopsis thaliana (thale cress): AT1G64480Help
Entry
AT1G64480         CDS       T00041                                 

Gene name
CBL8
Definition
(RefSeq) calcineurin B-like protein 8
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AT1G64480 (CBL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 842756
NCBI-ProteinID: NP_001319319
MIPS: AT1G64480.1
TAIR: AT1G64480
Araport: AT1G64480
UniProt: Q9FUQ7 A0A178W4X2 Q0V872
Position
1
AA seq 214 aa AA seqDB search
MLAFVKCFSLKRAKHPRGYEDPHVLASETPFTVNEIEALHDLFKKLSTSIINDGLIHKEE
FLLALFRNGSMQNLFADRVFYMFDRKRNGVIEFGEFVRSLSIFHPYTPEHEKSAFMFKLF
DLHGTGFIEPHELKKMVGALLGETDLELSEESIEAIVEQTMLEVDTNKDGKIDEEEWKEL
VAKNPSILKNMTLPYLKEVTLAFPSFVLDSEVED
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttggcattcgtgaaatgcttctcgttgaagcgagcaaagcatcctcgtggatatgag
gatcctcatgttcttgcatccgaaactcccttcaccgtgaatgagattgaggctttacac
gatttattcaagaagctaagtacatctattatcaatgatggtctaatccataaggaagag
tttcttctggctttgttcagaaacggcagtatgcaaaatctatttgcggacagggtgttt
tatatgtttgataggaaacgcaacggtgtgattgagtttggagaatttgttcgttccctt
agcatattccatccatacactcccgaacatgaaaaatctgcatttatgttcaagcttttt
gacctccatggaaccggcttcatcgagccccatgagctgaagaagatggttggcgcacta
cttggtgaaacagacttagaactctcggaagaatctattgaagctatcgtggaacagacg
atgctcgaggttgatacaaacaaagatgggaagattgatgaagaagagtggaaagagctc
gttgctaagaatccttcaatcctcaagaacatgactctgccttacctcaaggaagtgact
ttagcatttccaagctttgtactcgactctgaagttgaagactag

DBGET integrated database retrieval system