KEGG   Arabidopsis thaliana (thale cress): AT1G65040
Entry
AT1G65040         CDS       T00041                                 

Gene name
Hrd1B
Definition
(RefSeq) RING/U-box superfamily protein
  KO
K10601  E3 ubiquitin-protein ligase synoviolin [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT1G65040 (Hrd1B)
   04120 Ubiquitin mediated proteolysis
    AT1G65040 (Hrd1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT1G65040 (Hrd1B)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT1G65040 (Hrd1B)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT1G65040 (Hrd1B)
SSDB
Motif
Pfam: zf-RING_2 zf-rbx1 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 zf-ANAPC11 zf-RING_5 Prok-RING_4 Zn_ribbon_17 zf-RING_11 Zf_RING zf-C3HC4_4 DUF6533
Other DBs
NCBI-GeneID: 842812
NCBI-ProteinID: NP_849843
MIPS: AT1G65040.1
TAIR: AT1G65040
UniProt: Q6NPT7
Position
1
AA seq 460 aa
MIQLKVYAGLSTLATLVVIYHAFSSRGQFYPATVYLSTSKINLVVLLNMGLVLMLSLWNL
VKIVFLGSLREAEVERLNEQAWRELMEILFAITIFRQDFSVGFISLVVTLLLIKGLHWMA
QKRVEYIETTPSVTLLSHVRIVSFMVFLLILDCLLTYSSIQQLIQSRKASMSVFFTFEYM
ILATTTVSIIVKYAFYVTDMLKEGQWEGKPVYTFYLELVRDLLHLSMYLCFFLMIFMNYG
LPLHLIRELYETFRNFKIRVTDYLRYRKITSNMNDRFPDATPEELSSNDATCIICREEMT
SAKKLVCGHLFHVHCLRSWLERQNTCPTCRALVVPAENATSTASGNRGPHQESLQQGTGT
SSSDGQGSSVSAAASENMSRHEARFQAAASAASIYGRSIVYPSSANTLVWSQGNSLLPQT
EVEAQRRFLESQIEVLTNQLRLLEKPTTVDTKGKSVADTA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgattcagctaaaggtttacgcgggtctgagtactctcgcgacattggttgtgatatat
catgcttttagtagcagaggtcaattttacccagcgactgtgtatctatcaacgtctaag
atcaatttggtagttcttttgaacatgggtttggtattaatgttgagtttatggaatctt
gtcaaaattgtgtttttgggttctcttagagaagctgaagttgagcgtttgaatgagcaa
gcttggagagaactgatggagattctctttgctattactatttttagacaagatttctct
gttgggtttatctctttggttgtgactcttttgttgattaagggtttgcattggatggct
caaaagagagtggagtatattgagactactccttctgtgactttgctctctcatgtccgt
atagtttcttttatggttttcctccttatcttagattgtctccttacgtatagttctata
cagcaattgattcagtcacgtaaagcttcaatgtcagtcttcttcacgtttgagtatatg
attctggcaacaacaactgtttctattattgtgaagtatgccttctatgtcactgatatg
ctcaaggaaggtcaatgggaaggaaaaccagtatacactttctatctggagcttgttcgt
gacttgcttcacttgtccatgtatctttgcttcttcctgatgatattcatgaactatggc
cttcccttgcatctaatacgggagctctacgaaacgttcagaaacttcaagattcgtgtg
actgattaccttcgatatcggaaaatcacttccaatatgaatgatcggtttcctgatgca
actcctgaagaacttagttcaaatgatgccacttgtatcatatgtcgtgaagaaatgacc
tcagcgaagaaattagtatgtggccatctatttcatgtacattgtcttcggtcatggttg
gaacgacagaacacatgtcccacttgcagagcactggttgtcccagctgagaatgctaca
tcaacagcttctggaaaccgtgggccacaccaagaatccctgcagcaaggaaccggtact
tcaagttctgatggtcagggttcttctgtttctgctgctgccagtgagaatatgagcagg
cacgaggctaggtttcaagccgctgcttctgcagcctctatatatgggagatccattgtt
tatccatcttctgcaaacacactagtatggtctcaaggtaattcattacttcctcagacg
gaggtagaagctcaaagaagatttcttgagtcccaaatcgaggtgttaacgaaccaactt
cggcttttggagaaaccgacaactgtagatacgaaaggaaagtccgttgcggatactgca
tag

DBGET integrated database retrieval system