KEGG   Arabidopsis thaliana (thale cress): AT1G66070Help
Entry
AT1G66070         CDS       T00041                                 

Definition
(RefSeq) Translation initiation factor eIF3 subunit
  KO
K03245  translation initiation factor 3 subunit J
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT1G66070
Ribosome biogenesis [BR:ath03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    AT1G66070
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AT1G66070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 842921
NCBI-ProteinID: NP_001185326
MIPS: AT1G66070.1
TAIR: AT1G66070
Araport: AT1G66070
UniProt: Q9C8D8 A0A178WCY1
Position
1
AA seq 226 aa AA seqDB search
MDDWEDEKIAPLPAKVELKSNWDDEDVDENEIKDSWEDDDDEPAQPPVINPAPEKAPKKA
APKTVEKKGKAVEVPKEAPKEKPLDPIAEKLRQQRLVEEADYRATAELFGVKDDDKNLDM
FIPKSESDFLEYAEMISHRIKPYEKSYHYIALLKTIMRLSLTNMKAADVKDVASSITTIA
NEKLKAEKEAAAGKKKGGKKKQLIVDKANDDLVAGPYDAMDDFDFM
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggatgactgggaggacgagaaaattgcaccacttccagcaaaagttgagcttaaaagt
aactgggatgatgaagatgtggatgagaatgaaattaaggattcatgggaggatgatgat
gatgaacctgctcagccgcctgttataaatcctgctccggagaaggctcctaagaaagca
gcccccaaaactgttgaaaagaagggtaaagcagtcgaagttccaaaggaagcaccaaaa
gaaaaacctctagatcctatagcggagaaacttcgccagcagaggcttgttgaggaagcc
gactaccgggcaactgctgagctctttggagtgaaggatgatgacaaaaaccttgatatg
tttatccccaagtctgaaagcgattttttggaatatgctgaaatgatttctcataggatt
aaaccatatgagaaaagttatcactatatagcgctgctcaaaacaatcatgagactttca
ttgaccaacatgaaagcagctgatgttaaagatgttgcttcgtccattacaacgatagca
aatgaaaaactaaaggcagagaaagaagctgctgcgggaaaaaagaaaggtggaaagaag
aaacaacttattgtagataaggccaatgacgatctagtggctggtccttatgatgccatg
gatgacttcgacttcatgtag

DBGET integrated database retrieval system