KEGG   Arabidopsis thaliana (thale cress): AT1G66430
Entry
AT1G66430         CDS       T00041                                 
Name
(RefSeq) pfkB-like carbohydrate kinase family protein
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00051  Fructose and mannose metabolism
ath00500  Starch and sucrose metabolism
ath00520  Amino sugar and nucleotide sugar metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AT1G66430
   00500 Starch and sucrose metabolism
    AT1G66430
   00520 Amino sugar and nucleotide sugar metabolism
    AT1G66430
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     AT1G66430
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-GeneID: 842961
NCBI-ProteinID: NP_564875
TAIR: AT1G66430
UniProt: Q9C524
Position
1:24778257..24780742
AA seq 384 aa
MALQATTTTFCFSGPTFRSTPHSLTSKRPISIKATTSSPSRLSNSRSNLKGRALSSDGST
QESPYVVCFGEMLIDFVPTTSGLSLADAPAFKKAPGGAPANVAVGIARLGGSSAFIGKVG
EDEFGYMLANILKDNNVNNDGMRFDPGARTALAFVTLTNEGEREFMFYRNPSADMLLEES
ELDFDLIKKAKIFHYGSISLITEPCKSAHISAAKAAKEAGVILSYDPNLRLPLWPSADNA
REEILSIWETADIIKISEEEIVFLTKGEDPYDDNVVRKLFHPKLKLLLVTEGPEGCRYYT
KDFSGRVHGLKVDVVDTTGAGDAFVAGILSQLANDLSLLQDEERLREALMFANACGALTV
KVRGAIPALPTKEAVHEALLKAVV
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctctccaagccactactactacgttctgcttctccggtccaactttccgatcaact
cctcactcactcacttcaaaacgtcctatctccatcaaagctactacttcttctccttca
agactctccaattcacgatctaatctcaaaggaagagcattgtctagtgatggttcaaca
caagaatctccttatgtagtctgttttggagaaatgctaatcgattttgtaccgacgaca
agcggactttcattagccgatgcaccggcttttaaaaaagctccaggtggtgcacctgct
aatgtagctgttggtattgctcgtcttggtggttcttcagctttcattggaaaggttggt
gaagatgagtttggttatatgcttgcgaatattttgaaagataataatgtgaacaatgat
ggtatgaggtttgatccaggagcaagaactgctttagcttttgtgactttgactaatgaa
ggtgaaagagagtttatgttttaccgaaacccgagtgctgatatgttgttagaggagtct
gagcttgattttgatttgatcaaaaaggcaaagatatttcattacggttcgataagtctt
atcaccgaaccgtgcaagtctgcgcatatttctgcagctaaggcggctaaggaggctggt
gttatactctcttatgaccctaaccttaggcttccgttgtggccttctgcagacaatgct
agggaagagattctgagcatttgggagactgctgatattataaagataagtgaagaggag
attgtctttctaacgaaaggagaagatccgtatgatgataatgttgtacgcaagttgttt
catcctaagctgaaacttctccttgtcactgaaggtcctgaaggctgtcggtactacacc
aaggattttagtgggagagtgcatggattgaaggtggatgtagtggacacaacaggtgct
ggtgatgcatttgttgcggggatactatcgcaactagccaatgatctctccttgcttcag
gacgaagagcgactgagagaggctcttatgtttgcgaatgcatgcggggcattaaccgtt
aaagtgagaggcgcaatcccggcccttccaaccaaagaagctgtacatgaggctctactc
aaagccgtcgtttaa

DBGET integrated database retrieval system