KEGG   Arabidopsis thaliana (thale cress): AT1G68010
Entry
AT1G68010         CDS       T00041                                 
Symbol
HPR
Name
(RefSeq) hydroxypyruvate reductase
  KO
K15893  glycerate dehydrogenase [EC:1.1.1.29]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G68010 (HPR)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G68010 (HPR)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     AT1G68010 (HPR)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AlaDh_PNT_C NAD_binding_2 Peripla_BP_2 NAD_binding_7 NAD_Gly3P_dh_N Fibrillarin 3HCDH_N
Other DBs
NCBI-GeneID: 843129
NCBI-ProteinID: NP_176968
TAIR: AT1G68010
UniProt: Q9C9W5 A0A178WM81
Position
1:25493193..25496053
AA seq 386 aa
MAKPVSIEVYNPNGKYRVVSTKPMPGTRWINLLVDQGCRVEICHLKKTILSVEDIIDLIG
DKCDGVIGQLTEDWGETLFSALSKAGGKAFSNMAVGYNNVDVEAANKYGIAVGNTPGVLT
ETTAELAASLSLAAARRIVEADEFMRGGLYEGWLPHLFVGNLLKGQTVGVIGAGRIGSAY
ARMMVEGFKMNLIYFDLYQSTRLEKFVTAYGQFLKANGEQPVTWKRASSMEEVLREADLI
SLHPVLDKTTYHLVNKERLAMMKKEAILVNCSRGPVIDEAALVEHLKENPMFRVGLDVFE
EEPFMKPGLADTKNAIVVPHIASASKWTREGMATLAALNVLGRVKGYPIWHDPNRVDPFL
NENASPPNASPSIVNSKALGLPVSKL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcgaaaccggtgtccattgaagtgtataatcctaatgggaaatacagagttgttagc
acaaaaccgatgcctggaactcgctggatcaatctcttggtagaccaaggttgtcgcgtt
gagatatgtcatttgaagaagacaatcttgtctgtagaagatatcattgatctgatcgga
gacaagtgtgatggagtcatcggtcagttgacggaagattggggagagactctgttctca
gctttgagcaaagctggagggaaagctttcagtaacatggccgttggttataacaacgtt
gatgttgaagctgccaataagtatggaattgctgtcggtaacactccgggagtgttgact
gagacgacggctgaactagctgcttctctttccttggctgctgcaagaagaattgttgaa
gccgacgaattcatgagaggtggcttgtacgagggatggcttcctcatctgtttgtgggg
aacttacttaaaggacagactgttggagttattggagctggacgtattggatctgcttat
gctagaatgatggtggaagggttcaagatgaatttgatctactttgatctttaccaatcc
actcgtcttgagaaatttgtgacagcttatggacagttcttgaaagcaaatggagaacaa
cctgtgacatggaaacgagcttcgtccatggaggaggtgctgcgtgaggctgatctgata
agtcttcacccggtgctggacaaaaccacttaccatcttgtcaacaaggagaggcttgcc
atgatgaaaaaggaagcaatccttgtgaactgcagcagaggtcctgtgatcgatgaggca
gctttggtcgaacatctcaaagagaacccgatgttccgagttggtctcgatgtgttcgag
gaagagccattcatgaaaccagggcttgctgatacgaaaaacgctattgttgttcctcac
attgcttctgcttccaagtggactcgtgaaggaatggctacgcttgcagctctcaacgtc
ctcggaagagtcaaagggtacccgatttggcatgacccgaaccgagtcgatccattcttg
aacgaaaacgcttcaccgcccaatgccagtccaagcatcgtcaactcaaaggccttagga
ttgcctgtttcgaagctatga

DBGET integrated database retrieval system