KEGG   Arabidopsis thaliana (thale cress): AT1G68840
Entry
AT1G68840         CDS       T00041                                 

Symbol
RAV2
Name
(RefSeq) related to ABI3/VP1 2
  KO
K09287  RAV-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G68840 (RAV2)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   AP2/B3
    AT1G68840 (RAV2)
SSDB
Motif
Pfam: B3 AP2 DUF313
Other DBs
NCBI-GeneID: 843216
NCBI-ProteinID: NP_564947
TAIR: AT1G68840
UniProt: P82280 A0A178WNP0
Position
1:25880155..25882222
AA seq 352 aa
MDSSCIDEISSSTSESFSATTAKKLSPPPAAALRLYRMGSGGSSVVLDPENGLETESRKL
PSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEQEEAARSYDIAACRFRGRDAVVNFKN
VLEDGDLAFLEAHSKAEIVDMLRKHTYADELEQNNKRQLFLSVDANGKRNGSSTTQNDKV
LKTREVLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWR
FRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFERSTGLERQLYIDWKVRSGPRENPV
QVVVRLFGVDIFNVTTVKPNDVVAVCGGKRSRDVDDMFALRCSKKQAIINAL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattctagttgcatagacgagataagttcctccacttcagaatctttctccgccacc
accgccaagaagctctctcctcctcccgcggcggcgttacgcctctaccggatgggaagc
ggcgggagcagcgtcgtgttggatcccgagaacggcctagagacggagtcacgaaagcta
ccatcttcaaaatacaaaggtgttgttcctcagcctaacggaagatggggagctcagatc
tacgagaagcaccaacgagtatggctcgggactttcaacgagcaagaagaagctgctcgt
tcctacgacatcgcagcttgtagattccgtggccgcgacgccgtcgtcaacttcaagaac
gttctggaagacggcgatttagcttttcttgaagctcactcaaaggccgagatcgtcgac
atgttgagaaaacacacttacgccgacgagcttgaacagaacaataaacggcagttgttt
ctctccgtcgacgctaacggaaaacgtaacggatcgagtactactcaaaacgacaaagtt
ttaaagacgcgtgaagttcttttcgagaaggctgttacacctagcgacgttgggaagcta
aaccgtctcgtgatacctaaacaacacgccgagaaacactttccgttaccgtcaccgtca
ccggcagtgactaaaggagttttgatcaacttcgaagacgttaacggtaaagtgtggagg
ttccgttactcatactggaacagtagtcaaagttacgtgttgaccaagggatggagtcga
ttcgtcaaggagaagaatcttcgagccggtgatgttgttactttcgagagatcgaccgga
ctagagcggcagttatatattgattggaaagttcggtctggtccgagagaaaacccggtt
caggtggtggttcggcttttcggagttgatatctttaatgtgaccaccgtgaagccaaac
gacgtcgtggccgtttgcggtggaaagagatctcgagatgttgatgatatgtttgcgtta
cggtgttccaagaagcaggcgataatcaatgctttgtga

DBGET integrated database retrieval system