KEGG   Arabidopsis thaliana (thale cress): AT1G68890Help
Entry
AT1G68890         CDS       T00041                                 

Gene name
PHYLLO
Definition
(RefSeq) 2-oxoglutarate decarboxylase/hydro-lyase/magnesium ion-binding protein
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00130  Ubiquinone and other terpenoid-quinone biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AT1G68890 (PHYLLO)
Enzymes [BR:ath01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     AT1G68890 (PHYLLO)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     AT1G68890 (PHYLLO)
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     AT1G68890 (PHYLLO)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     AT1G68890 (PHYLLO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_1 Abhydrolase_6 TPP_enzyme_C Hydrolase_4 BAAT_C Ndr Abhydrolase_2 Abhydrolase_3 Thioesterase DLH Esterase DUF2974 LIDHydrolase SIR2_2
Motif
Other DBs
NCBI-GeneID: 843222
NCBI-ProteinID: NP_177055
MIPS: AT1G68890.1
TAIR: AT1G68890
Araport: AT1G68890
UniProt: Q15KI9
Position
1
AA seq 1715 aa AA seqDB search
MRSSFLVSNPPFLPSLIPRYSSRKSIRRSRERFSFPESLRVSLLHGIRRNIEVAQGVQFD
GPIMDRDVNLDDDLVVQVCVTRTLPPALTLELGLESLKEAIDELKTNPPKSSSGVLRFQV
AVPPRAKALFWFCSQPTTSDVFPVFFLSKDTVEPSYKSLYVKEPHGVFGIGNAFAFVHSS
SVDSNGHSMIKTFLSDESAMVTAYGFPDIEFNKYSTVNSKDGSSYFFVPQIELDEHEEVS
ILAVTLAWNESLSYTVEQTISSYEKSIFQVSSHFCPNVEDHWFKHLKSSLAKLSVEEIHP
LEMEHMGFFTFSGRDQADVKELKSIQSSCQFHCKLSPDVVFSNNMLNRETEVSNFLRDEA
NINAVWASAIIEECTRLGLTYFCVAPGSRSSHLAIAAANHPLTTCLACFDERSLAFHAIG
YAKGSLKPAVIITSSGTAVSNLLPAVVEASEDFLPLLLLTADRPPELQGVGANQAINQIN
HFGSFVRFFFNLPPPTDLIPVRMVLTTVDSALHWATGSACGPVHLNCPFRDPLDGSPTNW
SSNCLNGLDMWMSNAEPFTKYFQVQSHKSDGVTTGQITEILQVIKEAKKGLLLIGAIHTE
DEIWASLLLAKELMWPVVADVLSGVRLRKLFKPFVEKLTHVFVDHLDHALFSDSVRNLIE
FDVVIQVGSRITSKRVSQMLEKCFPFAYILVDKHPCRHDPSHLVTHRVQSNIVQFANCVL
KSRFPWRRSKLHGHLQALDGAIAREMSFQISAESSLTEPYVAHMLSKALTSKSALFIGNS
MPIRDVDMYGCSSENSSHVVDMMLSAELPCQWIQVTGNRGASGIDGLLSSATGFAVGCKK
RVVCVVGDISFLHDTNGLAILKQRIARKPMTILVINNRGGGIFRLLPIAKKTEPSVLNQY
FYTAHDISIENLCLAHGVRYVHVGTKSELEDALFVPSVEEMDCIVEVESSINANAIVHST
LERFARQAAENSLGIVSASSFLHPMIKNVLLCQVSGIQYSQYRVKLCDRPTICSDEFSQF
HREGFILSLTLEDGSIGYGEVAPLNSNVENLMDVEGQLQLVLHLMNEAKFSYMLPLLNGS
ISSWIWSELGITASSIFPSVRCGLEMALLNAMAVRHDSSLLGILHYQKEENGSAQPHSVQ
ICALLDSEGTPLEVAYVARKLVQEGFSAIKLKVGRRVSSVQDALVMQEVRRAVGVQIELR
ADANCRWTFEEAREFGLLVNSCNLKYIEEPVQNKDDLIRFHEETGLPVALDETLDDFEEC
PLRMLTKYTHPGIVAVVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYIL
FASYLEMENVKASTEQKQGTPPSVAHGLGTYRWLSEDVMMNTLGIFRSPYSGFVEGFIAD
ASRNLKDVKINNDVIVRTSKGIPVRRYELRVDVDGFSHFIRVHDVGENAEGSVALFLHGF
LGTGEEWIPIMTGISGSARCISVDIPGHGRSRVQSHASETQTSPTFSMEMIAEALYKLIE
QITPGKVTIVGYSMGARIALYMALRFSNKIEGAVVVSGSPGLKDPVARKIRSATDDSKAR
MMVDNGLYIFIENWYNGGLWKSLRNHPHFSKIAASRLLHGDVPSVAKLLSDLSSGRQPSL
WEELEDCDTNISLVFGEKDVKYKQIATRMYREMSKSKKSVNNIIEIVEIPEAGHAVHLES
PLRVILALRKFLTRVHNSSTETELSQKLLLALKEM
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcttcgtttctagtctcgaatcctccatttctaccttctctaatccctcgttac
agttctagaaaatccatcagacgtagcagagaacgcttctccttccctgagtctcttcgt
gtctctcttcttcatggaatccgaagaaacattgaggtcgctcaaggagttcaattcgat
ggtccgattatggatagagacgtgaatttggatgatgatttagtggttcaagtgtgtgtg
actcgtacattgcctccagctttgactcttgagcttggtctcgagagtctcaaggaagct
attgacgaattgaagactaatcctcctaagtcatctagtggagtcttacgatttcaagtg
gctgtgcctccaagggctaaagctttgttctggttttgctctcaaccaacgacttccgat
gtgtttcctgtgtttttcctctccaaggatactgttgagccttcttataaatcactttat
gtaaaggaacctcatggggtttttgggattgggaatgcattcgcttttgttcattcatct
tcagttgactccaatggacatagcatgatcaaaacattcctctcagatgaatcagctatg
gtgacggcctatggttttccagatattgaattcaacaaatactctactgtaaatagcaaa
gatggctcttcttactttttcgttcctcagattgagttagatgagcacgaggaggtctct
atattagcagttacattggcatggaatgaatctctctcttacacagttgagcaaacaatt
agttcatatgagaaatcaatttttcaggtttcttctcatttctgcccaaatgtagaggat
cactggttcaaacatctaaaaagttctttagcgaagcttagtgttgaagagatacatcca
cttgagatggagcatatgggctttttcaccttttctgggagagatcaggctgacgtcaag
gaactgaaaagtatacaatcatcatgtcagttccattgcaagctttcacctgacgttgtt
ttctcaaacaacatgctgaatcgagagactgaagtgagcaacttcttgagagatgaagct
aacatcaatgctgtatgggcatcagctataattgaagaatgcactcgtcttggtttgacg
tacttttgtgtagcccctggatcaaggtcttcccatcttgctatcgctgctgccaaccat
ccccttacaacgtgtcttgcatgctttgatgaacgatctcttgcgtttcacgctattggt
tatgctaaaggatccctcaaaccagcagtcattataacatcatcaggaactgccgtttca
aatcttcttccagcggttgttgaagccagtgaggatttcttaccactgctactacttacc
gcagatcgtcctcctgaacttcagggagttggcgcaaatcaagcaataaatcaaataaac
cacttcggttcgttcgtcagattcttcttcaatcttcctcctccaaccgatcttattcca
gtccgaatggtccttacgactgtagactccgctctacattgggcaacaggatctgcttgt
ggaccagtacatctcaattgtccttttagagacccacttgacggtagtccaacaaattgg
tcatctaactgcttaaatggattagacatgtggatgtctaatgctgagccattcacaaaa
tattttcaagtacaaagccataaaagcgatggtgtaacaactggccaaattactgagatc
ttacaagtaatcaaagaggctaagaagggtcttcttcttattggtgcaatccatacagag
gatgaaatttgggcttcgcttctgttggcgaaagagctgatgtggcctgtagttgcagat
gtcttgtctggtgtacggctgcgcaagctttttaaaccttttgttgagaagttgacgcat
gtttttgttgatcatcttgatcatgccttattttcagactctgtcaggaatttgatagag
tttgatgttgttatccaggttggaagtcggataacaagtaaaagagtttctcagatgcta
gagaaatgctttccatttgcatacattttggttgataagcatccatgccgacatgaccca
tcacacctggtcactcacagggtccaaagcaacattgttcagtttgctaattgtgtgctt
aaatctcgatttccatggaggagaagcaagttgcatggtcatctacaggcattggatggc
gctattgcccgggaaatgtcatttcaaatatctgctgaaagctccctgactgaaccttac
gttgcacatatgctttctaaagcactaacttctaaatctgctcttttcatcgggaatagt
atgccaataagggatgtggatatgtatggatgtagttcagaaaattcttctcatgtggta
gatatgatgttgagtgcagaactaccatgtcaatggatacaagtaactggaaatagagga
gctagtggcattgatgggttgctcagctcggccactggctttgctgtaggatgcaagaag
agagtggtctgtgtggttggggacatctctttccttcatgatacaaatggattggcgatt
ttgaagcagaggattgcaaggaaaccaatgacaattcttgtgataaacaaccgtggaggt
ggaatcttccgacttcttcctattgcaaagaaaacagagcctagcgtgttaaatcaatat
ttctatacagcacatgacatttccattgaaaacttgtgtttggcacatggtgtgaggtat
gttcacgttgggacgaaaagtgaacttgaggatgctctatttgtaccaagcgtggaggag
atggattgcattgtggaggttgaaagctctataaacgctaacgcgattgttcatagcact
ttggagaggtttgcacgccaagccgcagaaaattccctgggcattgtttctgccagttct
tttcttcatccgatgatcaaaaatgtacttctttgccaagtctctggaatacaatattcg
cagtacagagtcaaactgtgtgacagacctaccatatgttctgatgaattctctcaattc
catcgagaagggttcatactctccctgactttggaggatggaagcattggctatggagag
gttgcacctctgaacagtaatgtagagaacttaatggatgttgaggggcagcttcagtta
gttcttcacctcatgaatgaagctaaatttagttacatgcttcctttgttaaatggctcg
atttcttcctggatttggagtgaacttggaattactgcatcatcgattttccctagtgtc
agatgtggtctggaaatggctcttctaaacgcaatggcagtaagacatgattctagtttg
ttggggatacttcattatcagaaagaagaaaatggttctgctcagccacactctgttcaa
atatgtgcccttcttgattctgaaggtactccactggaggtcgcatacgttgctagaaaa
cttgttcaagaagggttcagtgctattaaacttaaagttggtcgtcgagtgagctctgtt
caagatgctttagttatgcaagaagtaaggagagccgttggcgttcaaattgaactccgt
gcagatgcaaattgtcgttggacttttgaagaggctagagagtttggtttattggtgaac
agctgtaatttaaaatatattgaggaacctgtccagaataaagatgaccttataaggttt
catgaagaaactggattaccagtggcacttgatgagactcttgatgattttgaggaatgt
cctctgcgtatgcttaccaaatatacgcaccctggaatagttgctgttgttattaaacca
agtgttgtgggagggtttgagaatgcagcactgattgctcggtgggcacagcagcatgga
aagatggctgttataagtgctgcatatgaaagtggcctaggtttatcagcatatatttta
tttgcatcatatttggagatggagaacgtgaaagcatccacagagcagaagcaaggaacg
cccccttctgtagcccatggtcttggaacttaccggtggcttagtgaagacgtaatgatg
aatacattagggatatttcgtagcccttacagtggatttgttgaaggatttattgctgat
gctagtagaaatctaaaggatgttaagataaacaacgatgttattgttagaaccagtaaa
ggaattcctgttcggaggtatgaactgagggtggatgtagatggtttctctcatttcata
agagtccatgacgttggggagaatgcagaaggaagtgtagctttgtttcttcatggattt
cttggaactggtgaagaatggatccccatcatgacgggtatctcaggatctgcgagatgc
atttcagtcgatattcctggtcacggaaggtcaagggtacaaagtcatgctagtgagacc
cagacgtccccaactttctcaatggagatgatagcggaggcattgtataagttgattgag
caaattactcctgggaaagtaaccatagttggatattccatgggagcaaggatagcactg
tacatggctttgaggtttagcaacaagatcgaaggagctgtcgtggtatcagggagcccg
ggactcaaggatccagtagcacggaaaattcgaagtgctacagatgattccaaagcacga
atgatggttgacaatggactatatatctttatcgagaattggtacaatggaggcttgtgg
aagagcttgagaaatcatccccattttagtaaaattgctgcaagccgcttgctacatggt
gatgttcctagtgttgcaaagctcctgtctgatctaagcagtgggagacaaccgtcattg
tgggaagagttggaggattgtgatacaaatatctcgctcgtattcggggagaaagatgtc
aaatacaagcaaatcgctactagaatgtaccgcgagatgagtaaaagcaagaagagcgta
aacaatatcatcgagatagttgaaattccagaggctggtcacgctgtacatctcgagagc
cctcttcgcgtgattctcgccctcagaaaattcttaacaagagttcacaacagttctaca
gagacagagctttctcagaagctcttgttagcactaaaagaaatgtaa

DBGET integrated database retrieval system