KEGG   Arabidopsis thaliana (thale cress): AT1G70610Help
Entry
AT1G70610         CDS       T00041                                 

Gene name
ABCB26
Definition
(RefSeq) transporter associated with antigen processing protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase AAA_33 AAA_22 AAA_29 ABC_ATPase Chordopox_A13L ABC_membrane_3 MMR_HSR1 DUF87 CPT DEAD AAA_30 SbcCD_C AAA_23
Motif
Other DBs
NCBI-GeneID: 843398
NCBI-ProteinID: NP_177218
MIPS: AT1G70610.1
TAIR: AT1G70610
Araport: AT1G70610
UniProt: Q8RY46 A0A178W3D9
Position
1
AA seq 700 aa AA seqDB search
MAQQVLGCTSRPIRVSLHRCSVITTSDTIRRKNLRFVRNPRLSFSLQSSTRNYRLPSINC
STVNGAVAETAEYYEGEGDNVSLAEKIRQCIDFLRTILPGGSWWSFSDEVDGRFIAKPVT
VWRALSRMWELVAEDRWVIFAAFSTLIVAALSEITIPHFLTASIFSAQSGDIAVFHRNVK
LLVTLCVTSGICSGIRGCFFGIANMILVKRMRETLYSTLLFQDISFFDSQTVGDLTSRLG
SDCQQVSRVIGNDLNMIFRNVLQGTGALIYLLILSWPLGLCTLVICCILAAVMFVYGMYQ
KKTAKLIQEITASANEVAQETYSLMRTVRVYGTEKQEFKRYNHWLQRLADISLRQSAAYG
IWNWSFNTLYHATQIIAVLVGGLSILAGQITAEQLTKFLLYSEWLIYATWWVGDNLSSLM
QSVGASEKVFQMMDLKPSDQFISKGTRLQRLTGHIEFVDVSFSYPSRDEVAVVQNVNISV
HPGEVVAIVGLSGSGKSTLVNLLLQLYEPTSGQILLDGVPLKELDVKWLRQRIGYVGQEP
KLFRTDISSNIKYGCDRNISQEDIISAAKQAYAHDFITALPNGYNTIVDDDLLSGGQKQR
IAIARAILRDPRILILDEATSALDAESEHNVKGVLRSIGNDSATKRSVIVIAHRLSTIQA
ADRIVAMDSGRVVEMGSHKELLSKDGLYARLTKRQNDAVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaagtactcggctgcacgagccgccccatccgcgtttctcttcaccggtgt
tctgttattaccaccagtgacactatcagaaggaagaatctccgattcgttagaaacccg
agattgtcgttttctcttcaatcttcaactagaaattatcgtctgccttcgattaattgc
tcgacggtgaatggagcagtagcggaaactgcggaatattacgaaggagaaggagataac
gtttcacttgctgagaaaatccggcaatgtattgatttcctccggacgattttaccaggt
ggaagctggtggagtttctccgatgaagttgatggtaggttcattgctaagcctgtgact
gtttggcgtgcgttaagtcggatgtgggaacttgtggctgaggatcgttgggttatcttc
gctgcgttttccactcttatagtagccgcgctttcagagataactattccgcatttttta
acagcttcgatcttctcggcacaaagtggtgatatcgctgtgtttcatcgaaatgtcaag
ctcttggttacgttatgtgttacttcaggcatttgcagtggcatacgaggatgcttcttt
gggattgctaacatgatacttgtgaaacgaatgagggaaacactatactccactcttctc
ttccaggatatatcatttttcgactctcaaactgttggtgacttaacaagcagacttggc
tcagactgtcagcaagtctcgagggtcatcggaaatgatctgaacatgatatttcgcaat
gttcttcagggtacaggggcattgatttatttgctaattttgtcttggccccttgggctg
tgcacattggtgatatgctgtattttggctgcggttatgttcgtttatgggatgtaccaa
aagaagacagcgaagctaattcaggagatcacagcttctgcaaatgaagtcgctcaagag
acatactctttgatgagaaccgttcgtgtatatgggacagagaagcaagagtttaaaagg
tacaatcactggcttcagagattggcggatataagtttgagacagagtgctgcatatggt
atttggaactggagcttcaacactctataccatgcaactcagattattgctgtcctggtt
ggaggattgtctatcttagctggtcaaataacagcagagcagctgacaaagtttctgttg
tatagtgagtggttaatctatgctacatggtgggtgggagataatttatcatctttgatg
caatcggttggagcaagtgaaaaggttttccaaatgatggatctcaagccaagtgatcaa
ttcatatcaaaaggaacgagactgcagagactgacaggacatatcgagtttgtagatgtg
tcatttagctacccttcaagagatgaggtagcggtggttcaaaacgtaaacatttccgtg
catcctggtgaagtggtagcaatcgttggtctaagtggcagtggcaaaagtacactggtt
aatcttttgctgcaactctacgaaccaacaagtggtcagattctactagatggggttcct
ttgaaagagttggatgtcaagtggcttaggcaaagaatcggatacgtggggcaggaacca
aagctcttccgcacagacatcagttcgaacatcaagtacggatgtgatcgtaatatatcg
caagaagatataatatcggctgcaaagcaagcctatgcacatgactttatcacagcactt
ccgaatggttacaacacaattgttgatgatgatctactcagtggagggcagaaacaacgg
attgccattgctcgtgccatccttagagatcctagaatcctcatcctcgatgaagccaca
agtgcactcgatgcagagagcgaacacaatgttaagggcgtacttcgttctatcggaaac
gactcagcaacaaagagaagcgtcatagtgatagcacacagactttctacaattcaagct
gcggatagaatagtggctatggacagtggacgagtcgtcgagatgggcagtcacaaagaa
cttttgagcaaagatggcttatacgcgagattgacgaagagacaaaacgatgccgtctta
tga

DBGET integrated database retrieval system