KEGG   Arabidopsis thaliana (thale cress): AT1G71880Help
Entry
AT1G71880         CDS       T00041                                 

Gene name
SUC1
Definition
(RefSeq) sucrose-proton symporter 1
  KO
K15378  solute carrier family 45, member 1/2/4
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G71880 (SUC1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   AT1G71880 (SUC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_2
Motif
Other DBs
NCBI-GeneID: 843519
NCBI-ProteinID: NP_177333
MIPS: AT1G71880.1
TAIR: AT1G71880
Araport: AT1G71880
UniProt: Q39232 A0A178W2N3
Position
1
AA seq 513 aa AA seqDB search
MGAYETEKPTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQL
LGIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGY
AADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVA
NAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVT
SLWYVNDKQWSPPPRNADDDEKTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPF
LLFDTDWMGREVFGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLGVEWIGRKLG
GAKRLWGIVNFILAAGLAMTVLVTKFAEDHRKTAGDLAGPSASVKAGALSLFAVLGIPLA
ITFSTPFALASIFSSCSGAGQGLSLGVLNLAIVIPQMIVSLGGGPFDALFGGGNLPAFIV
AAIAAAISGVLALTVLPSPPPDAPKATTMGGFH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggagcctatgaaacagaaaaaccaactaaagatgcggcggctctagagacacagtcg
ccggaagatttcgatcaaccatctccgcttcgtaaaatcatctccgtcgcttccatcgcc
gccggtgtacagttcgggtgggccttacagctctctcttcttactccgtacgttcaactc
ctcggaatccctcacaaatggtcatctctcatttggctctgtggtccagtctccggcatg
attgttcaaccaatcgtcggtttccacagtgaccgatgtaggtccaaatttggtcgccgt
cgtcctttcatcgccaccggagccgcactcgtcgccgtcgctgttttcctcatcggttac
gctgcggatttcggttataaaatgggagataaactcgaggagaaggttaaagttcgagct
atagggatctttgctctcgggttctggatcctcgacgtagccaacaacaccttacaagga
ccttgccgtgctttcttagccgacttagccgccggtgacgctaagagaacgcgagtcgca
aacgcgtttttctctttttttatggcggttggaaacgttttgggttatgcggctggttcg
tacactaacctccacaagatgtttccgttcacaatgacaaaagcttgcgatatctattgc
gccaatctcaagacttgtttcttcttatccatcactctcctcctcatcgtcaccgtcacg
tctctttggtacgttaatgacaaacaatggtctccgccgccgcgaaatgccgacgacgac
gagaagacctcaagcgttcctttgttcggtgaaatctttggagcattcaaagtcatgaaa
cgtcccatgtggatgcttctaatcgtcacggccttaaactggatcgcttggttcccattt
cttttgttcgatactgattggatgggtcgtgaagtgttcggtggagattcagatggaaat
gaacgatcgaagaaactatacagtcttggagtccaatctggtgcaatgggattgatgttt
aactctatagttcttggtttcatgtcacttggtgttgaatggattggtcggaaattagga
ggagctaaacggctttggggtattgtcaatttcatcctagccgctggtttggccatgacg
gttctcgttacgaaattcgccgaggatcaccggaaaaccgccggtgatttagccggaccg
agcgctagtgttaaagctggagctttaagtctctttgctgttcttggtatcccattagct
attactttcagtactccttttgctctagcatccatattctcaagctgctccggtgcaggc
caaggactttcattaggagttttaaatttggcgattgtgataccacaaatgatagtctca
ctaggaggtggacctttcgacgccttgttcggcggtggaaacttaccggcgtttatcgtt
gcagcaattgcagcggcgattagtggagtattagcgttaaccgttttaccttcaccacca
ccggacgcacccaaggcaacgaccatgggaggattccactag

DBGET integrated database retrieval system