KEGG   Arabidopsis thaliana (thale cress): AT1G72190Help
Entry
AT1G72190         CDS       T00041                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD AlaDh_PNT_C IlvN NAD_binding_2 TrkA_N Pyr_redox ELFV_dehydrog NAD_binding_7 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 843551
NCBI-ProteinID: NP_177364
MIPS: AT1G72190.1
TAIR: AT1G72190
Araport: AT1G72190
UniProt: F4IBQ3
Position
1
AA seq 373 aa AA seqDB search
MTIMFKIAKATLRSRNSSVASLFYSIQARSISRQSKVVKIERIVEKEDMHVTRVLFCGPH
FPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHICVAMTMQMDSNVISRASNIKLIM
QYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQNEMQISLRNR
LLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPFGSRVIATKRFWPASIVDSDSRLVDEK
GSHEDIYTFAGKADIVVVCLRLNKETAEIVNKEFICSMKKGALLVNIARGGLINYESAFQ
NLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSYRSMAKIVGDLALQL
HEGLPLTGIEFVN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacgataatgtttaaaatcgcaaaagctacgttacgaagcagaaactcaagcgtcgct
tcgctcttctactctatccaagctcgctctatctccaggcaaagtaaagtggttaagatt
gagagaatagttgagaaagaagacatgcatgtaactcgtgttctattctgcggtcctcac
ttccctgattcctacaatttcaccagagaatacttgcaaccttacccttttattaaggtt
gatgttgtccattaccgcgatgtccctgaggttattaagaactatcatatatgtgtggca
atgactatgcaaatggattcaaatgttatatctcgtgcaagcaacataaagcttattatg
cagtacggtgttggtctcgacggtgttgacattgatgctgctactaaacatgggattaag
gtcgctagaattcctagtgagggtactggaaatgctgcatcttgctctgagatggctata
tatctaatgctgggacttcttaagaaacagaacgaaatgcaaatatctctgagaaataga
ctacttggagaaccaaccggtgacacgcttcttggtaaaactgtatttatcttaggatat
ggaaacatcggaatagagctggctaaacggttgaagccatttgggtcgagagtaatagcc
acgaaaagattctggcctgcttctatcgtcgactcagactccaggctagttgatgagaaa
ggtagccatgaagacatttacacattcgctggcaaagccgatatagtcgttgtttgtttg
aggctcaacaaagaaacggctgaaatagtgaataaggagttcatatgctcaatgaaaaag
ggtgctcttcttgtaaatattgcccgaggtggtcttattaactatgaatcagctttccag
aatctggagtccggtcatctaggaggccttgggattgatgtggcgtggtctgagccgttt
gatccaaatgatcctattttgaagttcaaaaacgttataataacccctcatgtcgctgga
gttaccgaatattcatataggtccatggccaagattgtcggagacctcgcgcttcagttg
catgaaggacttcctctcaccggaatcgaattcgtcaattaa

DBGET integrated database retrieval system