KEGG   Arabidopsis thaliana (thale cress): AT1G72560Help
Entry
AT1G72560         CDS       T00041                                 

Gene name
PSD
Definition
(RefSeq) ARM repeat superfamily protein
  KO
K14288  exportin-T
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    AT1G72560 (PSD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ath03016]
    AT1G72560 (PSD)
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    AT1G72560 (PSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 zf-C3HC4_5 Clathrin
Motif
Other DBs
NCBI-GeneID: 843588
NCBI-ProteinID: NP_001077813
MIPS: AT1G72560.1
TAIR: AT1G72560
Araport: AT1G72560
UniProt: Q7PC79
Position
1
AA seq 988 aa AA seqDB search
MDDLEQAIVISFETGAVDSALKSQAVTYCQQIKETPSICSICIEKLWFSKLVQVQFWCLQ
TLQDVLRVKYGSMSLDEQSYVRKSVFSMACLEVIDNENAGRVVEGPPFVKNKLAQVLATL
IYYEYPLIWSSVFLDFMLHLCKGAVVIDMFCRVLNALDDELISLDYPRTPEEISVAARVK
DAMRQQCVPQIARAWYDIVSMYKNSDPDLSATVLDCMRRFVSWIDIGLVANDAFVPLLFE
LILSDGLSEQVRGAAAGCVLAMVSKRMDPQSKLPLLQTLQISRVFGLVSGDVDSDLVSKV
SALLTGYAVEVLECHKRLNSEDTKAVSMDLLNEVLPSVFYVMQKCEVDSTFSIVQFLLGY
VSTLKGLPALKEKQLLHITQILEVIRIQICYDPMYRNNLNSLDKTGLEEEDRMSEFRKDL
FVLLRTVGRVAPEVTQHFIRNSLANAVESSSESNVEEVEAALSLLYSFGESMTEEAMKTG
SGCLSELIPMLLTTQFPGHSHRLVALVYLENITRYMKFIQENSQYIPNVLGAFLDDRGLH
HQNFYVSRRAGYLFMRVVKLLKSKLVPFIDKILQNLQDTLSQLTTMNFASRELTGTEDGS
HIFEAIGIIIGLEDVPAEKQSDYLSLLLTPLCQQIEAGLVQAKVASSEDFPVKIANIQFA
IVAINALSKGFNERLVTASRPGIGLMFKQTLDVLLRVLIEFPKVEPLRSKVTSFIHRMVD
TLGSAVFPYLPKALEQLLADSEPKEMVGFMVLLNQLICKFNSALHDILEEVYPVVAVRIF
NVIPRDGLPSRPGAVTEEMRELIELQRMLYTFLHVIATHDLSSVFLTPKSRAYLDPMMQL
VLNTSCNHKDITVRKACVQIFIKLIKDWCAEPYSEEKVPGFQNFVIEAFATNCCLYSVLD
KSFNFSDANTHALFGEIITAQKVMYEKFGNTFLMHLMSKSFPSAHIPQDLAEQYCQKLQG
NDIRSLKSYYQSLIENLRLQQNGSHVFR
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccttgaacaggcaatagtaattagctttgaaactggtgctgttgattcggct
ttaaagtctcaagctgttacttattgtcagcaaatcaaagagactccttctatttgtagt
atatgtattgagaagttatggttttctaagcttgtccaagttcagttctggtgtttgcaa
acgcttcaggatgttttaagggttaaatatggatctatgagcttggatgagcagagttat
gtgaggaaatcagtgttttcaatggcttgtttggaggttattgataatgagaatgctggt
agagttgtggaaggacctccttttgttaaaaacaagcttgcacaggttttggctactttg
atctattatgagtaccctttgatttggtcctcggtgtttcttgatttcatgcttcatttg
tgcaaaggtgctgttgtgatcgacatgttttgtcgggttttgaatgccttggacgatgag
ttgattagcttggattacccccggacaccagaagagatatctgttgctgctcgagtcaag
gatgcaatgaggcaacaatgtgtccctcagatagccagagcatggtatgacattgtatcg
atgtacaagaattccgatcctgatctttctgctactgtgttagattgcatgagaagattt
gtatcttggattgacattggtttggttgccaatgatgcatttgttccactgctgtttgaa
ttgattttgtctgatggattgtctgaacaagtccgcggtgcagcagctgggtgtgtctta
gccatggtttctaagcggatggatccccagtcaaaactgccccttttgcagacccttcaa
atcagtcgtgtttttggtttagtatccggagatgttgattccgatttggtatcaaaagta
tctgctttgcttactggctatgctgttgaggttctagaatgccataagcgtttgaactca
gaggacaccaaggcagtctccatggatttgctgaacgaagttctgccatcagttttttat
gtcatgcagaagtgtgaggtggattctacttttagcatcgtccagtttctcctgggttat
gtttccactctcaaaggcctccctgcattgaaggagaagcagctgctccacattacacag
attctcgaagtgataagaattcagatttgctatgatcctatgtatcgtaataaccttaat
tcactggataaaactggattggaggaggaagatagaatgtccgagtttagaaaagatctc
tttgtcttattacgtacagtgggccgtgttgctcctgaagttactcagcatttcattcgt
aactcactagcaaatgctgttgaatcttcatcggagagcaatgttgaagaagtggaagct
gcgctctcgcttttgtattcattcggagagtctatgaccgaggaggccatgaaaacagga
tctgggtgtttgagtgaactaattccgatgctcttgaccacacagttccctggtcattca
catagacttgttgcactagtgtacttagaaaacataacaaggtacatgaagtttattcag
gaaaactcccagtacattcccaatgttcttggtgctttccttgatgataggggtttgcat
caccagaatttctatgtgagccgtagagctggttacttgttcatgagagtcgtgaaattg
ttaaaatcaaagcttgtaccattcattgacaagatcttgcagaaccttcaagatacgttg
tcccagttgacgactatgaactttgcatcaagagaacttactggaactgaagatggcagt
cacatttttgaggctattggcataatcatagggttggaggatgtcccggctgaaaagcag
tcagattatttgtctttactgcttacccctctctgtcaacagattgaggcaggacttgtg
caggcaaaagttgcaagttccgaagactttcctgtgaaaattgcaaatatccaatttgct
attgtggcaattaatgcgctcagcaagggcttcaacgaacgtcttgttactgctagtcgt
cctggaattggtctcatgtttaagcagacactggatgttcttctaagggtgctaattgaa
tttccaaaggtcgagcctttgcggagtaaggtcacatcattcatacaccgtatggttgat
acccttggatccgctgtgttcccttatcttcccaaggctttggaacagctacttgctgac
agtgagccaaaggaaatggttggtttcatggtattactcaatcagcttatctgcaaattc
aacagcgctctccatgatatactggaagaagtatatcccgtggttgctgttaggattttc
aatgtaattccaagagatgggctcccttcacgccctggggctgttactgaggaaatgagg
gaactgatagagcttcaaaggatgctgtatacatttcttcatgttatagccacacacgat
ctttcttctgtatttcttacgccgaaaagtagggcgtatctagatcctatgatgcagctg
gttttgaatacttcttgtaatcacaaggatattaccgtacgtaaggcgtgcgtgcagata
tttataaagcttattaaagattggtgtgccgagccatatagcgaggagaaggttccaggt
tttcagaatttcgtgatcgaagcgtttgcaacaaactgttgtttgtacagtgtgctagat
aaatccttcaatttcagtgatgcaaatacgcacgcattgttcggggaaatcatcacggct
cagaaagtaatgtatgaaaaatttggtaatacgtttctcatgcatcttatgtcgaaaagt
ttcccatcagcacatattccacaagatttggcggagcagtattgccaaaagttgcagggc
aatgatatccgaagcctcaagtcatactaccagtcccttatagaaaatctccggcttcaa
caaaacgggagtcacgttttcagatag

DBGET integrated database retrieval system