KEGG   Arabidopsis thaliana (thale cress): AT1G73020
Entry
AT1G73020         CDS       T00041                                 

Name
(RefSeq) anoctamin-like protein
  KO
K19327  anoctamin-10
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ath04040]
    AT1G73020
Ion channels [BR:ath04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   AT1G73020
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 843633
NCBI-ProteinID: NP_001320486
TAIR: AT1G73020
UniProt: A0MFS9 A0A178WEA6
Position
1:complement(27469496..27473660)
AA seq 665 aa
MNGSNGEERVVHEVAMVVPKRVLEEEEGDCVEVLVTELRKKGMVVDRVVGLAHEFLKVAA
PSEILGNAAAELHIRKPTRLGIDLPFEMQGSEAFIRQPDGLLFSWFERFRCYQHLIYGIV
NSGGHDVTLKLDGREFCWTAGESLLRRLESEGVIKQMFPLHDELKRKELLQNWALNWWNC
TNQPIDQIYSYFGAKIGVYFSFLGMYTQWLIFPALLGFIVQMVDFGSLQFLALPSFFVGT
ILWAALFLQFWKRKNAALLARWQINCLVGPSQGYRFLGMEWSSLPFPKELIKNLGNERAK
EKEAYQRYEWFAYRKRFRNDVLVIMSIICLQLPFELAYAHIFEIITSDIIKYVLTAIYLL
IIQYLTRLGGKVSVKLINREINESVEYRANSLIYKVFGLYFMQTYIGIFYHVLLHRNFMT
LRQVLIQRLIISQVFWTLMDGSLPYLKYSYRKYRARTKKKMEDGSSTGKIQIASRVEKEY
FKPTYSASIGVELEDGLFDDSLELALQFGMIMMFACAFPLAFALAAVSNVMEIRTNALKL
LVTLRRPLPRAAATIGAWLNIWQFLVVMSICTNSALLVCLYDQEGKWKIEPGLAAILIME
HVLLLLKFGLSRLVPEEPAWVRASRVKNVTQAQDMYCKQLLRSISGEFNSLTKPEQEQQQ
DSERF
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgaatgggagtaatggggaggagcgagttgttcacgaggttgcaatggtggttcctaag
agggttctggaagaagaagaaggagactgtgttgaggttttggtgactgagctaaggaag
aaagggatggttgttgatagagtcgtcggtcttgctcatgagtttctcaaggtagcagct
ccttcggagatcttgggcaatgcagctgcagagcttcatatacgcaaacctactcgtctc
ggaattgatcttccctttgagatgcaagggtctgaggctttcattcggcaacctgatggg
ttattattcagctggtttgaacgttttcggtgctatcaacatcttatttatggaattgta
aactctggtggacacgatgtcactctgaaacttgacggcagagagttttgttggacagca
ggggaatcattacttcgaaggttggaatcagagggcgtcattaaacaaatgtttcctctt
catgatgaactcaagagaaaggaacttctccaaaattgggcattaaattggtggaactgc
acaaaccaaccaattgatcagatctactcttactttggtgcaaagattggagtctacttt
tcgttcttgggaatgtatacgcaatggttgatatttccagccttacttgggtttatagtg
cagatggttgattttggatccttgcagtttcttgctctcccaagtttctttgtgggcaca
atactctgggctgccttgtttcttcagttctggaaacgtaaaaatgcggccttgttagcc
agatggcagataaattgtttagttggccccagccaaggatatagatttctcggaatggaa
tggagttcccttccttttccaaaggagcttattaagaatctcggaaatgagagagccaaa
gagaaggaagcctaccagagatatgaatggtttgcttatcgcaagaggtttaggaatgat
gttcttgttatcatgagcattatctgcctccaacttccatttgagctcgcgtatgctcat
attttcgagattatcacatctgatataatcaagtacgtattgacagctatctaccttcta
atcattcagtacctcactcggctaggagggaaagtatctgtcaagctgataaaccgagaa
atcaacgagagtgtggaataccgagctaacagcttgatttacaaagtttttgggctctat
tttatgcagacatatattgggatcttttatcatgttcttttacatcgaaacttcatgaca
cttcgacaagtattgatccaacggttaataatctcacaggttttctggactttgatggat
ggttctttaccttatcttaagtacagctaccgaaaatatcgagctaggacgaagaagaaa
atggaagatggatcatcaacagggaaaattcaaatagcctcaagagtggagaaggaatat
ttcaagcctacatattcagcaagcattggggtagaacttgaagatggacttttcgatgat
tccctcgagctggctttgcagtttggaatgattatgatgtttgcttgtgccttccctctt
gcttttgcccttgctgcagtgagcaatgtaatggaaataagaacaaatgctttaaagctt
ttggtgacacttcgaagacctcttcctcgtgctgctgcaacaattggagcttggttaaac
atctggcagtttctagtagttatgtccatatgcacaaactcggcactcttggtatgctta
tatgatcaagaaggcaaatggaagattgaaccgggactcgccgcaattctcatcatggaa
catgtactcttacttctgaaatttggactctctcgtctcgtccctgaagagcctgcttgg
gttagagccagtcgtgtgaagaacgtgacacaagcacaagacatgtactgtaaacagctc
ttaagaagcatttctggtgaatttaattccttgacaaaacctgaacaagaacaacaacaa
gactcagagcgcttttga

DBGET integrated database retrieval system