KEGG   Arabidopsis thaliana (thale cress): AT1G73100
Entry
AT1G73100         CDS       T00041                                 

Gene name
SUVH3
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3-like protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: SAD_SRA Pre-SET SET AWS
Other DBs
NCBI-GeneID: 843641
NCBI-ProteinID: NP_565056
MIPS: AT1G73100.1
TAIR: AT1G73100
UniProt: Q9C5P4 A0A5S9WTX3
Position
1
AA seq 669 aa
MQGVPGFNTVPNPNHYDKSIVLDIKPLRSLKPVFPNGNQGPPFVGCPPFGPSSSEYSSFF
PFGAQQPTHDTPDLNQTQNTPIPSFVPPLRSYRTPTKTNGPSSSSGTKRGVGRPKGTTSV
KKKEKKTVANEPNLDVQVVKKFSSDFDSGISAAEREDGNAYLVSSVLMRFDAVRRRLSQV
EFTKSATSKAAGTLMSNGVRTNMKKRVGTVPGIEVGDIFFSRIEMCLVGLHMQTMAGIDY
IISKAGSDEESLATSIVSSGRYEGEAQDPESLIYSGQGGNADKNRQASDQKLERGNLALE
NSLRKGNGVRVVRGEEDAASKTGKIYIYDGLYSISESWVEKGKSGCNTFKYKLVRQPGQP
PAFGFWKSVQKWKEGLTTRPGLILPDLTSGAESKPVSLVNDVDEDKGPAYFTYTSSLKYS
ETFKLTQPVIGCSCSGSCSPGNHNCSCIRKNDGDLPYLNGVILVSRRPVIYECGPTCPCH
ASCKNRVIQTGLKSRLEVFKTRNRGWGLRSWDSLRAGSFICEYAGEVKDNGNLRGNQEED
AYVFDTSRVFNSFKWNYEPELVDEDPSTEVPEEFNLPSPLLISAKKFGNVARFMNHSCSP
NVFWQPVIREGNGESVIHIAFFAMRHIPPMAELTYDYGISPTSEARDESLLHGQRTCLCG
SEQCRGSFG
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgcaaggagttcctggatttaatactgttccaaatcctaaccattatgacaaatcaata
gtgttagatattaaaccgttgcgaagtttgaaacctgtttttccaaatggtaatcaaggt
ccaccttttgttggttgtccaccttttggtccttcctcatctgagtattcttctttcttc
ccatttggagcacaacaaccaacgcatgatactccagatctcaaccaaactcagaacacg
cctattccatcatttgttccacctcttcgatcgtatagaacacctactaaaacaaatggc
cccagcagctccagtggaactaaaagaggtgttggtcgacctaagggaactactagtgtg
aagaaaaaagagaagaagactgtggccaatgagcctaacttagatgttcaggtagtgaaa
aaattcagttcagattttgacagtgggatcagtgcagcagagcgagaagatggaaatgcg
tacttagtaagtagtgtattgatgcgttttgatgcagttaggaggcggctcagccaagta
gaattcacaaagtccgctacttctaaagcagcaggtactctgatgagcaatggggtgcgg
acaaacatgaagaagagagttgggacggttcctggaattgaggttggagatatcttcttt
tcccggatagagatgtgtttagtgggtcttcacatgcagactatggctggcattgactat
ataattagtaaggccggttcagatgaagagtctttagcaactagcattgtttcatctgga
cgttatgaaggtgaagctcaggatcctgagtcattaatttacagtggacaaggcggcaat
gcagacaagaacagacaagcatctgatcagaagcttgaaaggggtaatctagcattagag
aatagcttgaggaagggaaatggagtaagagtcgtaagaggggaggaggatgcagcttcg
aaaacaggaaagatctatatctatgatgggctttattcgatctcagagtcatgggtagag
aaagggaaatctggttgcaacacctttaaatataaattggtgagacaacctggtcaacca
cctgcgtttggcttttggaaatctgttcagaagtggaaggaaggtttgactacaagacca
ggcctgatccttccagatctcacctcaggagctgaaagtaaacctgtttcacttgtgaat
gatgttgatgaggataaagggcctgcttattttacctatacctcctctctgaaatactca
gagacctttaaactaactcagcctgtaattggttgttcctgcagtggttcatgttcacca
ggaaatcataactgctcttgtatcagaaaaaatgatggtgatctcccttaccttaatggg
gttatactcgtttcccggaggcctgtgatatatgaatgtggcccaacgtgtccttgtcat
gccagttgcaaaaacagagtgattcagacaggactgaaatcccgcctggaagtgtttaag
acaagaaaccgcggttggggtttacgttcgtgggattccttacgtgctggttctttcata
tgtgaatatgctggtgaagtcaaagacaatggcaaccttagaggaaaccaagaagaggat
gcgtatgtctttgacacatcgcgtgtttttaactcgtttaagtggaattatgagcctgag
cttgtagatgaagacccttcaactgaagttcccgaagagtttaatctcccatcaccactc
ctaatcagtgccaagaaatttggcaatgtagctcggttcatgaaccatagttgctctcct
aacgttttttggcagccagttattcgtgaaggaaacggtgaatcagttatccacattgct
ttctttgccatgcgtcatatccctcctatggcagaattgacatatgattatgggatttct
cctacatccgaggccagagatgagagccttttacatggacagaggacatgtctctgtgga
tctgagcaatgtcgtggttcattcggatga

DBGET integrated database retrieval system