KEGG   Arabidopsis thaliana (thale cress): AT1G73480Help
Entry
AT1G73480         CDS       T00041                                 

Definition
(RefSeq) alpha/beta-Hydrolases superfamily protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00561  Glycerolipid metabolism
ath01100  Metabolic pathways
Module
ath_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT1G73480
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     AT1G73480
Peptidases [BR:ath01002]
 Serine Peptidases
  Family S33
   AT1G73480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 FSH1 Peptidase_S9 Abhydrolase_2 AXE1 LIDHydrolase Peptidase_S15
Motif
Other DBs
NCBI-GeneID: 843683
NCBI-ProteinID: NP_565066
MIPS: AT1G73480.1
TAIR: AT1G73480
Araport: AT1G73480
UniProt: Q94AM5
Position
1
AA seq 463 aa AA seqDB search
MICSSKGTILIARGKNSNTIPRLPLKGSSTNYANRIQIRNPISVKTFRRSSSSSMAVETM
SMGSDSSTLILTSGASGRVRVLFSMRELKRLVTIIQSLILFLLLPFRVVVWRRRTGAVVI
RDDKQERKVWSPPQIVVRKRNIGGESSVSPPSVPAAVVDGEVAVRRELAIKRVLEDEGGD
GSSVRDYSLFTTKRGDTLFSQSWSPLSPNHRGLIVLLHGLNEHSGRYSDFAKQLNANGFK
VYGIDWIGHGGSDGLHAYVPSLDYAVTDLKSFLEKVFTENPGLPCFCFGHSTGGAIILKA
MLDPKIESRVSGIALTSPAVGVQPSHPIFAVLAPIMAFLLPRYQISAANKKGMPVSRDPA
ALIAKYSDPLVFTGSIRVKTGYEILRITAHLQQNLNKVKVPFLVMHGTDDTVTDPSASKK
LYEEAASSDKSLKLYDGLLHDLLFEPEREIIAGAILDWLNQRV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgatctgttcaagtaaaggaacaatcttaatcgctagaggtaaaaattcaaatacaatc
cctagattacccctaaaagggtcatccacaaattacgcgaatcgaattcaaattcgaaac
ccaatcagtgtcaaaactttccggcgatcatcttcatcgtcaatggcggtggaaacaatg
tcgatgggatcagattcatcaactttgattctaacatcaggagcaagcggtcgcgttagg
gtactcttctcgatgcgagagcttaagcgtctcgttacgattatccaatcgttgattctt
ttcctcctccttccgtttcgcgtcgtcgtttggcggcggaggactggtgcggtggttatc
agagacgataagcaagagaggaaggtttggtctcctccgcagatcgtggtgaggaagagg
aacatcggtggcgaaagcagcgtttctcctccgtcggttccagctgcggtggtggatggg
gaggttgctgttcgacgtgaactggcgattaagcgagttttggaggatgaaggcggcgat
ggaagctccgtcagagattattcgctattcacgacgaagagaggagatacgttgtttagt
cagtcatggtcacctctttccccaaatcacaggggacttattgttctgctacatggatta
aacgagcatagtggcaggtatagtgattttgcaaagcagcttaatgctaatgggttcaag
gtctatggaattgactggatcggtcatggcggaagtgatggacttcatgcttacgttcct
tcccttgattacgctgtcacagatttgaaatcatttcttgaaaaggtattcacagagaat
ccaggactcccctgtttctgctttggacactcaacaggtggagcaatcatcctcaaggct
atgctggatccaaagattgaatctcgagtttcaggcattgcattgacttcaccagctgtt
ggagtccaaccatcccatccaatcttcgctgttcttgctccaatcatggcgtttctacta
cccaggtaccaaatcagtgcagcaaacaagaaaggaatgccggtttctcgtgacccagca
gctctcatcgccaaatactctgacccattagtcttcaccggatccatccgggttaaaacc
ggctacgagatccttagaatcactgctcacttgcaacagaacctgaacaaagtgaaagtt
ccctttcttgtgatgcacggtactgacgacacagttaccgatcctagcgcctcaaagaag
ctctacgaggaagctgcctcgtcagacaaatcactcaagctctacgacgggttgttgcac
gatcttctttttgaacccgaacgagaaatcatcgctggagccatattagattggctaaac
cagcgggtttag

DBGET integrated database retrieval system