KEGG   Arabidopsis thaliana (thale cress): AT1G74880
Entry
AT1G74880         CDS       T00041                                 
Symbol
NdhO
Name
(RefSeq) NAD(P)H:plastoquinone dehydrogenase complex subunit O
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: NdhO
Other DBs
NCBI-GeneID: 843827
NCBI-ProteinID: NP_565093
TAIR: AT1G74880
UniProt: Q9S829 A0A654EP16
Position
1:complement(28129828..28131077)
AA seq 158 aa
MAFSATVSQLSSLSTISSSLPISSRRLPHRSLPQFTVKAEAEKEKQSTQGKSDGEASPAA
TKTPKTLPKKPVYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLR
VFETGEYALVGWVGIPTAPAWLPTDMLIKCEKLVYERM
NT seq 477 nt   +upstreamnt  +downstreamnt
atggctttctctgcgactgtgtctcagctttcttctctttcaaccatctcctcttcatta
ccaatttcttctagaagactccctcatcgatctcttcctcaattcacagtcaaagcagaa
gcagagaaagagaaacagagcacacagggcaagtctgatggggaagcatcaccagctgca
accaaaacccctaaaaccctccccaagaaaccggtttactcgatgaagaagggccaaatc
gttcgtgtggaaaaagagaagtacctcaacagcatcaattacttatcagttggacatcct
cctttctacaaaggacttgattacatatacgaagatcgcggcgaggtcttggaccttcgt
gtctttgagacaggagagtatgcacttgttggatgggttggtatccccaccgcaccagct
tggctcccaacagatatgctcatcaagtgtgagaaacttgtttacgagcgaatgtag

DBGET integrated database retrieval system