KEGG   Arabidopsis thaliana (thale cress): AT1G75230Help
Entry
AT1G75230         CDS       T00041                                 

Definition
(RefSeq) DNA glycosylase superfamily protein
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AT1G75230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G75230
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     AT1G75230
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     AT1G75230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD DUF3780
Motif
Other DBs
NCBI-GeneID: 843860
NCBI-ProteinID: NP_565105
MIPS: AT1G75230.1
TAIR: AT1G75230
Araport: AT1G75230
UniProt: Q9C5J2
Position
1
AA seq 391 aa AA seqDB search
MGEHSPSQPSSHTLPPNQPESPNHETPNPIPPETNDDDSASSAGVSGSIVSSTTIEAPQV
TELGNVSSPPTKIPLRPRKIRKLSPDDDASDGFNPEHNLSQMTTTKPATKSKLSQSRTVT
VPRIQARSLTCEGELEAALHHLRSVDPLLASLIDIHPPPTFETFQTPFLALIRSILYQQL
AAKAGNSIYTRFVALCGGENGVVPENVLPLTPQQLRQIGVSGRKASYLHDLARKYQNGIL
SDSGIVNMDEKSLFTMLTMVNGIGSWSVHMFMINSLHRPDVLPVNDLGVRKGVQMLNGME
DLPRPSKMEQLCEKWRPYRSVASWYLWRLIESKNTPPNAAAATAGAALSFPQLEDIQQQE
QEQQHQQHQQQQPQLMDPLNNVFSIGAWGQT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaacattcaccttctcaaccatcatctcatactcttcctccaaaccaaccggaa
tcacccaatcacgaaacccctaatccaattccaccggaaaccaacgatgacgactccgcc
tcatccgccggagtttctggctcaatcgtctcatcaaccaccattgaagcaccacaagtc
actgaattaggcaatgtatcgtctccacctaccaagatccctctccgtcctcgaaaaatc
agaaaactttcacccgacgacgacgcttccgacggattcaatccggagcataacctttct
cagatgacgacgacgaaaccggcaacgaagagtaaattatcacagtcacgcactgtaacc
gtgccgagaatccaagcaaggtctctcacttgtgaaggcgagcttgaagcagctcttcac
catctccgaagtgttgatcctctgctcgcgtctttaatcgacattcatccaccaccaacg
ttcgagacttttcagactccgttcttggcgttgattcgaagcattctttatcagcaatta
gcagctaaagcaggtaattcaatctacacacgcttcgttgccttatgcggcggtgaaaac
ggcgtcgtgccagagaatgtattgcctttaacacctcaacagcttcgtcaaattggtgtt
tccgggcgtaaagcgagttaccttcatgatcttgctaggaaatatcaaaatgggatcttg
tcggattctggaatagtgaatatggatgagaaatctttgttcacgatgttaacaatggtg
aatgggattgggtcatggtcggtccatatgtttatgataaactctcttcatagacctgat
gtgttaccagttaatgatcttggtgtaaggaagggtgtgcagatgcttaatggtatggag
gatttgcctcgtccatccaaaatggagcagctttgcgagaaatggcgtccgtatagatca
gtagcgtcttggtacttgtggcggctcattgaatctaaaaatacaccacctaatgctgcg
gctgctacggccggagctgctctttcgtttccacagttggaagacattcagcaacaagaa
caagaacagcaacatcaacaacatcagcaacaacagccgcagcttatggaccctcttaat
aatgtgttcagtatcggggcatggggccaaacgtag

DBGET integrated database retrieval system