KEGG   Arabidopsis thaliana (thale cress): AT1G75390
Entry
AT1G75390         CDS       T00041                                 

Gene name
bZIP44
Definition
(RefSeq) basic leucine-zipper 44
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 SR-25 Shugoshin_N HAUS-augmin3 Miff bZIP_Maf DUF4200 Dsh_C
Other DBs
NCBI-GeneID: 843875
NCBI-ProteinID: NP_177672
MIPS: AT1G75390.1
TAIR: AT1G75390
UniProt: C0Z2L5 A0A178W597
Position
1
AA seq 173 aa
MNNKTEMGSSTSGNCSSVSTTGLANSGSESDLRQRDLIDERKRKRKQSNRESARRSRMRK
QKHLDDLTAQVTHLRKENAQIVAGIAVTTQHYVTIEAENDILRAQVLELNHRLQSLNEIV
DFVESSSSGFGMETGQGLFDGGLFDGVMNPMNLGFYNQPIMASASTAGDVFNC
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaataataaaactgaaatgggatcttccacaagtggaaattgctcgtcggtttcaacc
actggtttagctaactccggttcagaatctgatctccggcaacgtgatctaatcgacgag
cggaagagaaagaggaaacagtcgaacagagaatctgcgaggaggtcgaggatgaggaag
cagaagcatttggatgatctcactgctcaggtgactcatctacgtaaagaaaacgctcag
atcgtcgccggaatcgccgtcacgacgcagcactacgtcactatcgaggcggagaacgac
attctcagagctcaggttcttgaacttaaccaccgtctccaatctcttaacgagatcgtt
gatttcgtcgaatcttcttcttcaggattcggtatggagaccggtcagggattattcgac
ggtggattattcgacggcgtgatgaatcctatgaatctagggttttataatcaaccaatc
atggcttctgcttctactgctggtgatgttttcaactgttag

DBGET integrated database retrieval system