KEGG   Arabidopsis thaliana (thale cress): AT1G75470
Entry
AT1G75470         CDS       T00041                                 
Symbol
PUP15
Name
(RefSeq) purine permease
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PUNUT Spo7
Other DBs
NCBI-GeneID: 843883
NCBI-ProteinID: NP_177680
TAIR: AT1G75470
UniProt: Q9LQZ0
Position
1:28330054..28331300
AA seq 387 aa
MGHNQPMQSSNPQEHFVQIALDIEHRLTTPISLTSDSNQRRNQWVTIIICTILAVTGQCI
ARLLENYYFLHKNLSRRRGILTQTLLQVVGFPILLLPFLLHFLIKKQKQLLIFSGETSLK
HLAITYSILCIYMFCQAFFSDVRNQIPYRVFTLTYTTQLLFTLIFSKYYNDIKFNRWTFI
SLILAVLAGAFTLYTFSAGSPIYGKKSYGYGIINVAFGAAIFFSLLLCIIRKVFEELISF
CNTSTNRKQPSFVVVLEMIIFLSLVVTIILVAAVLISGEHHDMKKEMETFTKGDIAYVRT
MVGQAVAWQIYWVGIVGLVFAVSAVFSNVISVCTWPIVSLLVAFLYNTHDHFDVFRGIAL
GAAALSVSCYIYIIHKEKSDDDDQSTS
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgggacataatcaaccaatgcagtcgtcaaatccacaagaacactttgtgcaaatagcc
ctggatatcgagcaccgcctaaccacaccgatcagcctaacaagtgactcgaatcagaga
cgtaaccagtgggttaccatcatcatatgcaccatcttggccgtaacaggtcaatgcatc
gctagactcctcgagaactattacttcctccacaaaaacctgagccgccgccgcggtatc
ttgactcaaacacttctccaagtcgtcggattccccatcctccttctccctttccttctc
cacttcctcatcaagaaacagaaacaacttctcattttctccggtgaaacctccctcaag
cacttagccataacttactctattctctgcatctacatgttttgtcaagcatttttctcc
gacgttagaaaccagataccctatagagttttcactctcacttacacgacgcagctatta
ttcaccctgattttctccaagtattacaacgatatcaaatttaatagatggacgtttatc
tctctcatcttagccgtcctcgccggcgctttcactctctacactttctccgccgggtca
cccatctacgggaagaaatcctacggctatggaattattaatgtggctttcggcgctgcc
atctttttctccttgctcctctgcattatcaggaaggtgttcgaggaacttatctctttc
tgcaacacatccaccaacagaaaacaacccagtttcgttgtcgttctcgagatgatcatc
ttcttgtctctcgtcgtaaccatcatcttagtcgcagccgttttaatctctggtgaacat
cacgatatgaagaaagagatggaaacgttcacgaagggagatattgcctacgtgaggact
atggtgggtcaagccgttgcatggcagatctactgggtcgggatcgtggggctagtgttc
gctgtctccgccgtgttctcgaacgtgatcagtgtctgtacgtggccgatcgtgtcgctt
ctagtggcttttttatataacacgcacgatcatttcgatgtcttcagaggaatcgcctta
ggcgcagctgctcttagcgtctcgtgttatatctatattattcacaaagagaagagcgac
gatgatgaccaatccacaagctaa

DBGET integrated database retrieval system