KEGG   Arabidopsis thaliana (thale cress): AT1G75860Help
Entry
AT1G75860         CDS       T00041                                 

Definition
(RefSeq) DNA ligase
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3474 EOS1
Motif
Other DBs
NCBI-GeneID: 843919
NCBI-ProteinID: NP_001322891
MIPS: AT1G75860.1
TAIR: AT1G75860
Araport: AT1G75860
UniProt: A0A1P8AVE0
Position
1
AA seq 377 aa AA seqDB search
MDLTLHFFFYSPHALSYLLPLTVCSRSRFFRVYLRIWVSEIELTGLSRLFLFRLLESEAN
LGLIGLLESRPKSFDWIRENMSRVLTCPPLVFARNHVGVQNLVESTKLKRITLDSKKAHR
IEKKEKKEKRKEKKETKREKSHKHSIKATDNHHKLIFLPSKKVSDESDSLEKSGLTDELE
EPQKHLGYLSDGSQNSKKRIRDDSPPAVESLIKAAPVAGKPLRIRMVFKKPKEEVPTLPR
EAVVCSTTVAKSLSHQDVITSSISSSKTSELEKNLPSTSIAAIDETKKRKKHRSSKEDQY
NALFDGWTPPSMCIADASSNDNGDYWLFGNKTQEVLKPKAAVKVDDDTMMRPGDSSWPRA
QFLSEVGIYSLPYTVPF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaccttacccttcacttttttttttattcaccacacgcgcttagctatcttctcccc
ctcactgtctgctctaggtcgagattttttagggtttatctccggatttgggttagcgaa
atcgagctcacggggttgtctcgattattcctttttaggttgcttgaatctgaagctaat
cttgggttaattggattgttagaatcgagacctaaatccttcgattggatcagagaaaat
atgtcgcgcgttctcacttgcccaccgcttgtgtttgcaagaaaccacgttggcgttcaa
aacttggtcgaatcgactaagcttaaaagaatcacacttgattcaaaaaaggcgcaccgg
atagagaagaaggaaaagaaggagaagagaaaagaaaagaaagaaactaagcgtgagaaa
tcgcataaacattcgattaaagcaactgataatcatcacaagctaatatttcttccttcc
aagaaagtgtcagatgagtctgactcactagagaagagtggtttgacagatgagcttgag
gaacctcaaaaacaccttggatatttgtctgatggaagtcagaatagtaagaagaggatt
agagatgattctcctccggctgttgaaagtctcatcaaagctgcacctgtagcaggtaaa
cctctacggattagaatggtcttcaaaaaaccaaaggaggaagttcctactctgcctaga
gaggctgttgtttgctccactacagttgcaaagtcgctcagtcaccaagatgtcataaca
agttctatctcaagttcaaaaacatccgagcttgaaaagaatctgccgtcaacatcaata
gcggcaatagatgaaacaaagaagagaaagaaacacagatctagcaaagaagatcaatac
aatgcattgtttgatggttggactcctccttccatgtgtattgctgatgcatcttcaaat
gacaatggtgattattggctatttgggaacaagacgcaagaggtgcttaagcccaaagca
gcagtcaaggttgatgatgacacgatgatgagaccgggagattcatcttggcctagagct
caatttttgtctgaagttgggatttattctttaccttatactgtcccgttctaa

DBGET integrated database retrieval system