KEGG   Arabidopsis thaliana (thale cress): AT1G76040Help
Entry
AT1G76040         CDS       T00041                                 

Gene name
CPK29
Definition
(RefSeq) calcium-dependent protein kinase 29
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT1G76040 (CPK29)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT1G76040 (CPK29)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT1G76040 (CPK29)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   AT1G76040 (CPK29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 Kinase-like EF-hand_11 SPARC_Ca_bdg EFhand_Ca_insen Kdo RIO1 tRNA_synt_1c_R1 DUF5580
Motif
Other DBs
NCBI-GeneID: 843936
NCBI-ProteinID: NP_974150
MIPS: AT1G76040.1
TAIR: AT1G76040
Araport: AT1G76040
UniProt: Q8RWL2
Position
1
AA seq 561 aa AA seqDB search
MLQNQHKTTKNQRNKNIGTKYFLRKKIMGFCFSKFGKSQTHEIPISSSSDSSPPHHYQPL
PKPTVSQGQTSNPTSNPQPKPKPAPPPPPSTSSGSQIGPILNRPMIDLSALYDLHKELGR
GQFGITYKCTDKSNGREYACKSISKRKLIRRKDIEDVRREVMILQHLTGQPNIVEFRGAY
EDKDNLHLVMELCSGGELFDRIIKKGSYSEKEAANIFRQIVNVVHVCHFMGVVHRDLKPE
NFLLVSNEEDSPIKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVLHRNYGKEIDVWSAGV
MLYILLSGVPPFWGETEKTIFEAILEGKLDLETSPWPTISESAKDLIRKMLIRDPKKRIT
AAEALEHPWMTDTKISDKPINSAVLVRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQT
FKNMDTDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVDKSGTIDYIEFVTATMHR
HRLEKEENLIEAFKYFDKDRSGFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRIN
YEEFVAMMRKGTTDSDPKLIR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaaaccaacataaaacgaccaaaaaccagagaaacaaaaacattggaacaaaa
tattttcttagaaaaaaaattatgggattttgcttctccaaatttggcaaatcacaaaca
catgagatcccaatctcttcctcttccgattcaagccctcctcatcactaccaacctctc
cctaaaccaactgtttctcaaggtcaaaccagtaatcccacctccaatcctcagcccaaa
cccaaacccgctcctcctcctcctccgtcaacatcctccggttcacaaatcggtccaatc
ctaaaccgaccaatgatcgatctctcagctctctacgacctccacaaagaactcggccgt
ggccaattcggaatcacttacaaatgcacggacaaatccaacggtcgagaatacgcctgc
aaatccatctcaaaacgtaaactcatacgtcgcaaagacatcgaagacgtgagacgtgag
gtcatgatcttgcaacaccttactggtcaaccaaacatagtcgagtttcgaggcgcgtat
gaagacaaagacaatcttcatttggttatggagctctgttctggaggagagctttttgat
cgtattatcaagaaaggaagttactctgagaaagaagctgctaatatcttcagacagatc
gttaatgttgttcatgtttgtcacttcatgggcgttgttcatagagacttaaagcctgag
aatttcttgcttgttagtaacgaagaagattctccaatcaaagcaacagattttggactc
tctgttttcatcgaagaaggtaaagtgtatagagatatagttgggagcgcatactacgtt
gcacctgaagttctacatcgaaactacgggaaagaaatcgatgtatggagcgcgggtgtt
atgctttacattcttctcagtggtgttcctccattttggggagagaccgagaagactata
tttgaggcgatcttagaaggaaagctggatcttgaaacttctccttggcctactatatcg
gaaagcgcaaaagatttgataagaaagatgttgataagagatcctaaaaaaaggataacc
gcagctgaagcacttgagcatccatggatgacagacaccaaaatttctgataaaccaatc
aatagtgctgttcttgttaggatgaagcaattccgcgcgatgaacaagctcaagaaactt
gccttgaaggtgatagcggaaaacttatcggaagaagagataaaaggattaaagcaaacg
tttaagaacatggatacagatgaaagtggcaccatcacttttgatgaactaagaaacggg
ttacatcgtcttggatctaagcttacggagtctgaaatcaaacaactcatggaagctgct
gatgtggacaaaagtgggacgattgattacattgagtttgtaactgcaacaatgcatcgt
catagattggagaaagaagagaatttgatagaagcatttaaatacttcgacaaagacaga
agcggttttatcacaagggacgagcttaaacactccatgactgagtatggcatgggtgat
gatgcgaccatagatgaagttatcaatgatgttgataccgacaatgatgggaggataaac
tacgaggaatttgtggcgatgatgaggaaaggaactacagattcagatccaaagctgatc
agatga

DBGET integrated database retrieval system