KEGG   Arabidopsis thaliana (thale cress): AT1G76340
Entry
AT1G76340         CDS       T00041                                 
Symbol
GONST3
Name
(RefSeq) golgi nucleotide sugar transporter 3
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: TPT DNApol_Exo Astro_p19 ATP19
Other DBs
NCBI-GeneID: 843966
NCBI-ProteinID: NP_177760
TAIR: AT1G76340
UniProt: Q9S845 A0A178WDB8
Position
1:complement(28634881..28636968)
AA seq 372 aa
MSTNDEENGTVIEVKNVPEPSPETWYSVFLRQASVYGVAAGYCLSASLLSIINKWAIMKF
PYPGALTAMQYFTSAAGVLLCAQMKLIEHDSLNLLTMWRFLPAAMIFYLSLFTNSELLLH
ANVDTFIVFRSAVPIFVAIGETLFLHQPWPSVKTWGSLATIFGGSLLYVFTDYQFTIAAY
SWALAYLVSMTIDFVYIKHVVMTIGLNTWGLVLYNNLEALLLFPLELLIMGELKKIKHEI
TDETDWYSLQVVLPVGLSCLFGLAISFFGFSCRRAISATGFTVLGIVNKLLTVVINLMVW
DKHSTFVGTLGLLVCMFGGVMYQQSTIKKPNATQEAKPQEQDEEQEKLLEMQENKESNSV
DIKETLKSEEKL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcgacgaatgatgaggaaaatggaactgtaatcgaggttaagaatgttccagaacca
agcccagagacttggtatagtgtttttcttcgtcaagcttctgtctatggtgtagctgct
ggttactgtctctcagcttctcttctctcaatcatcaacaaatgggcaatcatgaagttt
ccttaccccggcgcattgaccgcgatgcagtactttacaagtgcagctggtgtcttgctt
tgtgctcagatgaagctaattgagcatgattcgcttaatctattgaccatgtggcggttt
cttcccgcagctatgatattctacttgtctctgtttaccaacagtgagcttctcctccac
gccaatgtcgatactttcatcgtgtttcgctctgctgttccgattttcgttgccattggg
gaaacgcttttcttgcatcagccatggccatctgttaaaacgtggggatctttggctact
atatttggtggaagtttgctttacgttttcacggattatcagtttacaatcgcagcttat
agctgggctcttgcgtatctggtgagtatgactatagactttgtttacatcaagcatgtg
gttatgacgattggcttgaacacttggggacttgttctctacaataaccttgaggctctg
cttttgtttccccttgagctgcttataatgggagagttaaagaagataaagcatgaaatc
actgacgagactgattggtactcgttgcaagtggttttacccgtgggtttatcgtgtctt
tttggcttggctatctctttcttcgggttctcatgtcgtcgggccatttctgcaacgggg
ttcaccgttcttggaattgtgaacaagctgttgacagtggtgatcaatttgatggtgtgg
gataaacattcaacgtttgttggaaccttggggctcttggtttgtatgtttggtggagtc
atgtatcaacagtctaccatcaagaaaccgaatgctacacaagaagctaaaccgcaagag
caagacgaggaacaagagaaacttcttgaaatgcaggagaacaaggagagtaacagcgtc
gatataaaggaaactctgaaatcagaagagaaactatga

DBGET integrated database retrieval system