KEGG   Arabidopsis thaliana (thale cress): AT1G76670
Entry
AT1G76670         CDS       T00041                                 

Name
(RefSeq) Nucleotide-sugar transporter family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: TPT EamA SLC35F Halogen_Hydrol Phage_r1t_holin
Other DBs
NCBI-GeneID: 844000
NCBI-ProteinID: NP_001319390
TAIR: AT1G76670
UniProt: Q9SRE4 A0A076LAS9 A0A654EPI8
Position
1:complement(28772563..28775002)
AA seq 347 aa
MEKPESEKKSAVSDVGAWAMNVISSVGIIMANKQLMSSSGFGFGFATTLTGFHFAFTALV
GMVSNATGLSASKHVPLWELLWFSIVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVL
EWILHSKHYCKEVKASVMVVVIGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQ
KKYSVGSFELLSKTAPIQAISLLICGPFVDYLLSGKFISTYQMTYGAIFCILLSCALAVF
CNISQYLCIGRFSATSFQVLGHMKTVCVLTLGWLLFDSEMTFKNIAGMAIAIVGMVIYSW
AVDIEKQRNAKSTPHGKHSMTEDEIKLLKEGVEHIDLKDVELGDTKP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagaaaccggagagcgagaagaaatcggcggtgtctgatgtcggtgcatgggctatg
aatgtaatcagctccgttggaatcatcatggctaataaacagctcatgtcttcctctggt
ttcggttttggctttgctacaacgttaacgggatttcactttgcattcactgctcttgtt
ggtatggtgtcaaacgcaacgggactatcagcttctaagcatgttcctctttgggagctt
ctctggttctcaattgttgctaatatctctatcgctgctatgaactttagtcttatgctc
aactctgttggcttctatcagatttcgaaattgagcatgattccggtggtatgcgtgttg
gaatggattctacatagcaagcattattgtaaagaagtgaaagcttctgtaatggttgtg
gttatcggtgttgggatttgtactgtgactgatgtcaaagttaatgccaaaggtttcatt
tgtgcatgcactgccgttttctccacttctctgcagcagatttctataggctctctgcag
aagaagtactcagtaggatcctttgaattgctgagcaaaactgcaccaatccaagccatt
tcacttctcatctgtggcccctttgttgactatttgttgagcggcaaattcatatctact
taccagatgacttatggtgccatcttctgcattcttctctcctgtgcattagccgttttc
tgtaacataagccaatatctctgcatcggaagattctcagcgacatctttccaagttcta
ggccacatgaaaacagtatgcgtcctcacattaggatggcttctctttgattccgagatg
acattcaagaacatcgccgggatggccatagccattgttggaatggtgatctatagttgg
gctgttgatatagagaaacagaggaacgcaaagtcaacgccacacggcaaacacagtatg
accgaagatgagattaagctactcaaagaaggagttgagcatatcgacttgaaagacgtt
gaactcggtgacactaaaccataa

DBGET integrated database retrieval system