KEGG   Arabidopsis thaliana (thale cress): AT1G78080Help
Entry
AT1G78080         CDS       T00041                                 

Gene name
RAP2.4
Definition
(RefSeq) related to AP2 4
  KO
K09286  EREBP-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G78080 (RAP2.4)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   EREBP
    AT1G78080 (RAP2.4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AP2
Motif
Other DBs
NCBI-GeneID: 844143
NCBI-ProteinID: NP_177931
MIPS: AT1G78080.1
TAIR: AT1G78080
Araport: AT1G78080
UniProt: Q8H1E4
Position
1
AA seq 334 aa AA seqDB search
MAAAMNLYTCSRSFQDSGGELMDALVPFIKSVSDSPSSSSAASASAFLHPSAFSLPPLPG
YYPDSTFLTQPFSYGSDLQQTGSLIGLNNLSSSQIHQIQSQIHHPLPPTHHNNNNSFSNL
LSPKPLLMKQSGVAGSCFAYGSGVPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT
FDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICK
SMAETQKQDKSTKSSKKREKKVSSPDLSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLS
DLTFADPEEPPQWNETFSLEKYPSYEIDWDSILA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgctatgaatttgtacacttgtagcagatcgtttcaagactctggtggtgaa
ctcatggacgcgcttgtaccttttatcaaaagcgtttccgattctccttcttcttcttct
gcagcgtctgcgtctgcgtttcttcacccctctgcgttttctctccctcctctccccggt
tattacccggattcaacgttcttgacccaaccgttttcatacgggtcggatcttcaacaa
accgggtcattaatcggactcaacaacctctcttcttctcagatccaccagatccagtct
cagatccatcatcctcttcctccgacgcatcacaacaacaacaactctttctcgaatctt
ctcagcccaaagccgttactgatgaagcaatctggagtcgctggatcttgtttcgcttac
ggttcaggtgttccttcgaagccgacgaagctttacagaggtgtgaggcaacgtcactgg
ggaaaatgggtggctgagatccgtttgccgagaaatcggactcgtctctggcttgggact
tttgacacggcggaggaagctgcgttggcctatgataaggcggcgtacaagctgcgcggc
gatttcgcccggcttaacttccctaacctacgtcataacggatctcacatcggaggcgat
ttcggtgaatataaacctcttcactcctcagtcgacgctaagcttgaagctatttgtaaa
agcatggcggagactcagaaacaggacaaatcgacgaaatcatcgaagaaacgtgagaag
aaggtttcgtcgccagatctatcggagaaagtgaaggcggaggagaattcggtttcgatc
ggtggatctccaccggtgacggagtttgaagagtccaccgctggatcttcgccgttgtcg
gacttgacgttcgctgacccggaggagccgccgcagtggaacgagacgttctcgttggag
aagtatccgtcgtacgagatcgattgggattcgattctagcttag

DBGET integrated database retrieval system