KEGG   Arabidopsis thaliana (thale cress): AT1G79620
Entry
AT1G79620         CDS       T00041                                 

Name
(RefSeq) Leucine-rich repeat protein kinase family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LRR_8 LRR_4 LRRNT_2
Other DBs
NCBI-GeneID: 844301
NCBI-ProteinID: NP_001321900
TAIR: AT1G79620
UniProt: A0A1P8ASH0
Position
1:complement(join(29958201..29958451,29958526..29958745,29958842..29958981,29959136..29959288,29959364..29959839,29959918..29960052,29960133..29960204,29960290..29960364,29960446..29960514,29960602..29960673,29960757..29960828,29960911..29960985,29961068..29961229,29961324..29961395,29961497..29961571,29961663..29961734,29961857..29961980,29962066..29962174))
AA seq 807 aa
MVGSNTVTATSRLLLICFAYSFTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDP
CGTPWEGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGD
LQKLNILILAGCGFTGTIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADN
QLTGPIPISSGSSPGLDLLLKAKHFHFNKNQLSGTIPPKLFSSEMILIHVLFDGNRFTGS
IPSTLGLIQTLEVLRLDRNTLTGKVPENLSNLTNIIELNLAHNKLVGSLPDLSDMKSMNY
VDLSNNSFDPSESPLWFSTLPSLTTLVMEYGSLQGPLPNKLFGFPQLQQVRLKKNAFNGT
LSLGDTVGPELQLVDLQDNDISSVTLSSGYTNTLILEGNPVCTTALSNTNYCQIQQQQVK
RIYSTSLANCGGKSCPLDQKVSPQSCECAYPYEGTLYFRGPMFRDLSNVNTYHSLEMSLW
VKLGLTPGSVSLQNPFFNNDDYLQIQLALFPPMGKYFNRTEVQRIGFDLSNQTYKPPPLF
GPYYFIASPYTFPADGNGHSLSSRMVTGIITGCSALVLCLVALGIYAMWQKRRAEQAIGL
SRPFVSWASSGKDSGGAPQLKGARWFSYEELKKITNNFSVSSELGYGGYGKVYKGMLQDG
HMVAIKRAQQGSTQGGLEFKTEIELLSRVHHKNLVGLVGFCFEQGEQILVYEYMSNGSLK
DSLTGRSGITLDWKRRLRVALGSARGLAYLHELADPPIIHRDVKSTNILLDENLTAKVAD
FGLSKLVSDCTKGHVSTQVKGTLVSFR
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggtgggttccaacaccgtaaccgctacatcgcggttgctcttgatctgttttgcttac
tcattcactgtcttctcaatgatttcatcagtgactgatcctcgtgatgcggcggctctg
cgttctttgatggatcaatgggacaatacgccgcctagttggggaggttctgatgatcct
tgtggaactccttgggaaggtgtatcttgcaataactccagaatcactgctttgggtttg
tcaacaatgggtctcaaaggaagacttagtggagatattggagaactagctgaactaaga
tcattggatctttcctttaatcgaggactaacaggttcacttacttctcggttaggagac
ctgcaaaagctaaatatccttattcttgctggttgtggcttcactggtaccatcccaaat
gagcttggctatctcaaagatctatctttcttggccttgaactcgaacaacttcacgggt
aaaatcccggcgtctctaggaaatctcactaaggtttattggctggatcttgcggataat
cagttgacaggacccattccaatttcatcaggctcaagtcctggtcttgatcttcttttg
aaagccaaacactttcatttcaacaagaatcagctctctgggaccattccaccaaaactt
ttcagctctgagatgatactgatccatgtattattcgatggaaatcgattcacaggaagc
ataccttccactttaggactcattcagacactagaggttcttcggcttgacagaaacact
ttgaccggaaaagttccagagaatctcagtaatctcacaaacatcattgaactgaactta
gctcacaacaagctcgttggatcattaccagatttgtcagacatgaagtccatgaactac
gtagatctcagcaataactcatttgatccatcagagtctcctctctggttctcaacctta
ccttcactgaccacacttgtgatggaatatggatctcttcaaggaccactacctaataag
ctctttgggttcccacagcttcaacaagtgagactgaagaagaacgcattcaatggaaca
ctgagcttgggagacacagtaggtccagagctccaacttgttgatctacaagacaacgac
atatcctctgtaacactaagctctggatataccaatacattaatactcgaaggaaatcct
gtatgcacaacagctctctccaacacaaactactgtcagattcagcagcaacaagtcaaa
cgaatatactcgaccagtcttgctaactgtggaggaaagtcttgtccattagaccaaaag
gtcagccctcagagctgtgaatgcgcctacccttatgaaggcacactctacttccgaggg
cctatgttcagagacctgtccaatgtgaacacataccattctttggagatgagcttgtgg
gtgaaattaggactcactccaggctcggtctctctacaaaaccctttcttcaacaatgat
gattatcttcagatacagttggcacttttcccacctatgggcaagtattttaacagaact
gaagttcagagaattggatttgacttgagtaaccaaacatataaacctcctcctttgttt
ggaccttactacttcattgcatctccctacacattcccagctgatggtaacggacattcc
ttgagctctcggatggtcactgggataataactggttgcagtgctttggtcctgtgcctt
gttgcgttaggaatatacgcaatgtggcagaagagacgtgcagagcaagctatcggtttg
agtagaccatttgtttcatgggcatcaagtggaaaagacagcggtggcgcaccgcagctg
aaaggggcacgatggttctcctacgaagaactcaagaagatcacgaacaatttctctgtg
agcagtgagctgggttatggaggttatggaaaggtgtataaaggaatgcttcaagatggg
cacatggtggcgatcaaaagagcacaacaaggatcaacacaaggagggctcgagttcaaa
acagagattgagttgctttctcgagttcatcacaagaacctagttgggcttgtcgggttc
tgcttcgagcaaggcgagcagattctagtctacgaatacatgtccaacggatcactaaaa
gatagcttaaccgggcgatccggaattacgctggattggaaaagaaggctgagagtggct
ctaggatcggcaagaggactcgcatacctccatgaactggcggatcctccgatcatccac
agggacgtgaaatcaactaacattcttttggatgagaatctgacagccaaggttgctgat
tttggtttgtccaagctggtttcagactgcaccaaaggccatgtttcaacacaagttaaa
ggaacattggtaagttttagataa

DBGET integrated database retrieval system