KEGG   Arabidopsis thaliana (thale cress): AT1G79870Help
Entry
AT1G79870         CDS       T00041                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase family protein
  KO
K15919  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G79870
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G79870
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     AT1G79870
    1.1.1.81  hydroxypyruvate reductase
     AT1G79870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 844326
NCBI-ProteinID: NP_178105
MIPS: AT1G79870.1
TAIR: AT1G79870
Araport: AT1G79870
UniProt: Q9CA90 A0A178W4H7
Position
1
AA seq 313 aa AA seqDB search
MESIGVLMMCPMSSYLENELEKRFNLLRFWTSPEKSVLLETHRNSIRAVVGNASAGADAQ
LISDLPNLEIVSSFSVGLDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLRRLC
ECDRYVRSGKWKQGEFQLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSRTIKPD
VAYKYYPTVVDLAQNSDILVVACPLTEQTRHIVDRQVMDALGAKGVLINIGRGPHVDEQE
LIKALTEGRLGGAALDVFEQEPHVPEELFGLENVVLLPHVGSGTVETRNAMADLVVGNLE
AHFSGKSLLTPVV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaatcggagtccttatgatgtgccccatgtcctcctacctcgagaacgagctt
gagaagcgcttcaaccttcttcgcttctggacttctccggagaaatccgtcctcctagaa
actcatcggaactccatccgcgccgtcgttgggaatgcttctgccggcgccgatgctcag
ctcatcagcgatctgcccaaccttgagattgtatccagcttcagcgtcgggctcgacaag
atcgatttggggaaatgcaaagaaaaagggatccgcgtcaccaacacccccgacgttctc
accgaagacgtcgcagatctcgccatcgggcttatcctggctctccttcgacggctgtgt
gagtgcgatcgctatgtaaggagcggaaaatggaagcaaggtgaattccaactcactacc
aagtttagtggaaaatccgtggggatcattggtctaggtagaattgggactgccatcgca
aagagggctgaagcctttagctgcccaatcaattactactcaagaaccattaagcctgat
gtcgcctacaagtattatccgacggtggttgaccttgctcaaaactcagacatcctcgtc
gtcgcatgcccgttgaccgagcagaccagacacattgtggaccggcaggtcatggatgca
ttaggagctaagggcgtcctcataaacattggccgtggaccacatgttgatgagcaagag
cttattaaagctctaacagaaggccgcctaggtggggctgcccttgatgtgtttgagcag
gagcctcacgtgcccgaggagctctttggccttgagaatgtagttctcctccctcacgtt
gggagtggcactgtggaaacacggaatgccatggccgatcttgtcgtgggtaacttggaa
gcgcacttttctgggaaatcacttctgactccggtcgtctga

DBGET integrated database retrieval system