KEGG   Arabidopsis thaliana (thale cress): AT1G80300Help
Entry
AT1G80300         CDS       T00041                                 

Gene name
NTT1
Definition
(RefSeq) nucleotide transporter 1
  KO
K03301  ATP:ADP antiporter, AAA family
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: TLC DUF1467
Motif
Other DBs
NCBI-GeneID: 844370
NCBI-ProteinID: NP_178146
MIPS: AT1G80300.1
TAIR: AT1G80300
Araport: AT1G80300
UniProt: Q39002 Q0WW68
Position
1
AA seq 624 aa AA seqDB search
MEAVIQTRGLLSLPTKPIGVRSQLQPSHGLKQRLFAAKPRNLHGLSLSFNGHKKFQTFEP
TLHGISISHKERSTEFICKAEAAAAGDGAVFGEGDSAAVVASPKIFGVEVATLKKIIPLG
LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLSK
KALFYTVIVPFIIYFGAFGFVMYPLSNYIHPEALADKLLTTLGPRFMGPIAILRIWSFCL
FYVMAELWGSVVVSVLFWGFANQITTVDEAKKFYPLFGLGANVALIFSGRTVKYFSNLRK
NLGPGVDGWAVSLKAMMSIVVGMGLAICLLYWWVNRYVPLPTRSKNKKEKPKMGTMESLK
FLVSSPYIRDLATLVVAYGISINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGVATFT
MMLLSQYVFNKYGWGVAAKITPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYV
GALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL
SFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFNSLRSEEELEKEMERASSVKIPVVSQ
DESGNGSLGESPSSSPEKSAPTNL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtgattcaaaccagagggcttctctctttacccaccaaacccatcggagtg
agaagccaacttcagccttcccatggcttaaagcagagacttttcgccgcgaagccaaga
aatctacatgggttgtctctatcctttaacgggcacaagaaatttcaaacctttgagcca
accctgcatgggatttcgatttcccacaaagagagaagcaccgagttcatatgcaaggcg
gaggccgcggctgctggcgacggagctgtcttcggcgaaggcgattccgcagctgttgta
gcctcgccgaagattttcggtgtggaggttgcaaccttgaaaaagattatccctttagga
ttgatgttcttttgtattcttttcaattacacaattctgagggatacaaaggatgtcttg
gtggtgacggcgaaaggaagttctgctgagattatacctttcttgaagacttgggtgaat
cttcctatggccattgggtttatgctcctctacactaaactctccaatgttctctccaag
aaggctctgttttacactgttattgtccctttcatcatctactttggggcctttggtttc
gtcatgtaccctctcagcaactatattcacccggaagctctcgcagataagctccttaca
accctcggcccaagattcatgggtcctattgcaatattgcggatttggagtttctgtttg
ttttatgttatggctgagctttggggtagtgtggtggtctcagttctcttctggggcttt
gctaatcagatcacaactgtggatgaagccaagaaattctatcctttgttcggacttgga
gccaatgttgcactgattttctcaggaagaaccgtgaaatacttctctaacttgagaaag
aatcttggtcctggagttgacggctgggcagtttcgttgaaagccatgatgagcattgtg
gtgggaatgggactcgccatttgtctcctctattggtgggtcaatagatatgttcctctt
ccaacccgtagcaagaacaagaaggagaaaccgaagatgggaacgatggaaagcttgaag
ttcttggtatcatcaccatacattagagatcttgctactttagtggtggcatacggtatt
agtatcaatcttgtggaagtcacatggaaatcaaagcttaaagctcagttccctagcccg
aatgagtactcagcatttatgggagacttctcaacctgcacgggtgttgcaacattcaca
atgatgcttctcagccaatacgtattcaataagtatggttggggagtagctgcaaagatc
accccaactgttctgctattgactggtgttgcgttcttctctctaatattgtttggcggc
ccattcgcaccacttgttgccaagcttggtatgacaccgctacttgcagctgtgtatgtc
ggtgcccttcagaatatcttcagcaagagtgccaagtacagcttgttcgacccttgcaaa
gaaatggcctatatcccattggatgaggacaccaaggttaaaggcaaagctgcgattgac
gtggtctgcaacccattagggaaatcagggggagctttaatacagcagttcatgatctta
tcctttggatcactagcgaattcaacgccgtatctaggaatgatcttgttggttattgtc
actgcgtggttagctgcagctaagtcgctggagggacagttcaacagcttgcggtctgaa
gaagagcttgagaaggaaatggagagagcttcatcggtgaagatccctgtcgtgtctcag
gacgaaagcggaaacggttcccttggagaatctcctagcagttcaccggagaaatctgct
cccaccaacttataa

DBGET integrated database retrieval system